BLASTX nr result
ID: Ophiopogon27_contig00055083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00055083 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC16754.1| hypothetical protein RhiirA5_406637 [Rhizophagus ... 63 2e-09 dbj|GBC22280.1| hypothetical protein RIR_0930800 [Rhizophagus ir... 56 2e-07 dbj|GBC49700.1| Tis13_34576: PROVISIONAL [Rhizophagus irregulari... 55 2e-06 gb|EXX75702.1| hypothetical protein RirG_039560 [Rhizophagus irr... 55 2e-06 >gb|PKC16754.1| hypothetical protein RhiirA5_406637 [Rhizophagus irregularis] gb|PKY13292.1| hypothetical protein RhiirB3_425084 [Rhizophagus irregularis] gb|PKY27705.1| hypothetical protein RhiirB3_443512 [Rhizophagus irregularis] Length = 163 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 294 CLDKSPIEEADEQISSTNETIEIKCDDLEELE 199 CLDKSPIEEADEQISS +ETI+IKCDDLEELE Sbjct: 52 CLDKSPIEEADEQISSADETIDIKCDDLEELE 83 >dbj|GBC22280.1| hypothetical protein RIR_0930800 [Rhizophagus irregularis DAOM 181602] Length = 112 Score = 56.2 bits (134), Expect = 2e-07 Identities = 36/80 (45%), Positives = 50/80 (62%) Frame = -3 Query: 252 SSTNETIEIKCDDLEELEQQITFRSLNKWKVGTVNVLRKFKIYQRQLITGIRQKKTKLTW 73 S +NE IEIK DDLEELEQQI F SLN ++ T+N R F + +L+ +QK+TK Sbjct: 13 SDSNEIIEIKHDDLEELEQQIIFSSLN--EIPTLNAYRIFNYIKDKLLVSSKQKETK--- 67 Query: 72 NNASLLHLNILPCLVFRILH 13 N +L L+ CL+ R ++ Sbjct: 68 NKHKVLVLD--KCLLLRSIY 85 >dbj|GBC49700.1| Tis13_34576: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 139 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -3 Query: 366 EIARTSKRTQIKT----SASVSFNSES*CLDKSPIEEADEQISSTNET 235 EIAR+++ TQIKT SA+V +S+S CLDKSPIEEADEQIS +ET Sbjct: 88 EIARSNRGTQIKTTKGSSATVFSDSKSQCLDKSPIEEADEQISIADET 135 >gb|EXX75702.1| hypothetical protein RirG_039560 [Rhizophagus irregularis DAOM 197198w] Length = 151 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 4/48 (8%) Frame = -3 Query: 366 EIARTSKRTQIKT----SASVSFNSES*CLDKSPIEEADEQISSTNET 235 EIAR+++ TQIKT SA+V +S+S CLDKSPIEEADEQIS +ET Sbjct: 100 EIARSNRGTQIKTTKGSSATVFSDSKSQCLDKSPIEEADEQISIADET 147