BLASTX nr result
ID: Ophiopogon27_contig00054977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054977 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC63828.1| hypothetical protein RhiirA1_232361 [Rhizophagus ... 59 2e-08 >gb|PKC63828.1| hypothetical protein RhiirA1_232361 [Rhizophagus irregularis] Length = 95 Score = 59.3 bits (142), Expect = 2e-08 Identities = 36/56 (64%), Positives = 43/56 (76%), Gaps = 2/56 (3%) Frame = -2 Query: 511 FFLEVNYILVLAVLNYIMGLVRNPEIRDPEGTLS-RHSKSETSKSRIAII-LTIHK 350 F LEVNYIL+LAVLNYIMGLV + +GT+ +KSETSKSRIAII +T+HK Sbjct: 41 FLLEVNYILILAVLNYIMGLVNSKS----QGTVHYPDTKSETSKSRIAIIPMTLHK 92