BLASTX nr result
ID: Ophiopogon27_contig00054880
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054880 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY59234.1| hypothetical protein RhiirA4_481810 [Rhizophagus ... 58 1e-07 >gb|PKY59234.1| hypothetical protein RhiirA4_481810 [Rhizophagus irregularis] Length = 157 Score = 58.2 bits (139), Expect = 1e-07 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = +3 Query: 204 LRVFKARRLRRVFGSLDATFRQPLRNFFGVNSQLLRNF--LDGLLFRSGR-VGFRRLSLW 374 L VFKARRL +VF SLD TF Q L+N+F + + ++ + GLLFR R VGFR+LSLW Sbjct: 92 LGVFKARRLCQVFSSLDMTFNQLLQNYFDMVNFFETSWTQIYGLLFRKSRYVGFRQLSLW 151 Query: 375 RGIT 386 GI+ Sbjct: 152 CGIS 155