BLASTX nr result
ID: Ophiopogon27_contig00054820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054820 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020081720.1| uncharacterized protein LOC109705399 [Ananas... 38 2e-07 >ref|XP_020081720.1| uncharacterized protein LOC109705399 [Ananas comosus] Length = 198 Score = 38.1 bits (87), Expect(3) = 2e-07 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 1 RFERMWLRQEGFRDCMAYLVATSDP*VSHCRQFSGKIWICS-ECKKWCKTNFYSVKKKKN 177 RFER+WL +E F + P S S K+ C K+W KTNFYS+ K Sbjct: 55 RFERVWLSKEDFAANVPCWWNEVTPKTSAILTLSAKLRHCRIRIKEWRKTNFYSISSTKR 114 Query: 178 L 180 L Sbjct: 115 L 115 Score = 33.5 bits (75), Expect(3) = 2e-07 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 317 RSKVRWLIEGDNNTKFFH 370 RSK WL EGD+NTKFFH Sbjct: 161 RSKQFWLEEGDSNTKFFH 178 Score = 30.0 bits (66), Expect(3) = 2e-07 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +3 Query: 204 VELLEESGDLSSVERAQREYLNVEYKLLTNKE*VIWN 314 ++LLEE LS R +R+ + +++++ +E ++WN Sbjct: 123 IDLLEERFALSHESRDRRDAIKAQFQIILQEEEILWN 159