BLASTX nr result
ID: Ophiopogon27_contig00054789
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054789 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK61096.1| uncharacterized protein A4U43_C08F26210 [Asparagu... 55 3e-06 ref|XP_020267811.1| cytokinin dehydrogenase 3-like [Asparagus of... 55 5e-06 >gb|ONK61096.1| uncharacterized protein A4U43_C08F26210 [Asparagus officinalis] Length = 504 Score = 55.5 bits (132), Expect = 3e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 412 WDRFKELKNRFDPLNVLTPGQRIFKRNLIDS 320 W+RF+++K RFDPLNVLTPGQRIFKR ID+ Sbjct: 459 WNRFRKMKERFDPLNVLTPGQRIFKRKSIDN 489 >ref|XP_020267811.1| cytokinin dehydrogenase 3-like [Asparagus officinalis] gb|ONK69513.1| uncharacterized protein A4U43_C05F23770 [Asparagus officinalis] Length = 507 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 412 WDRFKELKNRFDPLNVLTPGQRIFKRNLI 326 WDRFK+LK+RFDPLNVL PGQRIFKR I Sbjct: 477 WDRFKDLKSRFDPLNVLAPGQRIFKRKPI 505