BLASTX nr result
ID: Ophiopogon27_contig00054677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054677 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63194.1| hypothetical protein RirG_154570 [Rhizophagus irr... 158 1e-47 >gb|EXX63194.1| hypothetical protein RirG_154570 [Rhizophagus irregularis DAOM 197198w] dbj|GBC33277.1| hypothetical protein RIR_1821600 [Rhizophagus irregularis DAOM 181602] gb|PKC11558.1| hypothetical protein RhiirA5_497593 [Rhizophagus irregularis] gb|PKC76507.1| hypothetical protein RhiirA1_527919 [Rhizophagus irregularis] gb|PKK77307.1| hypothetical protein RhiirC2_732335 [Rhizophagus irregularis] gb|PKY17440.1| hypothetical protein RhiirB3_521998 [Rhizophagus irregularis] gb|PKY43007.1| hypothetical protein RhiirA4_540800 [Rhizophagus irregularis] gb|POG79732.1| hypothetical protein GLOIN_2v1525550 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 294 Score = 158 bits (400), Expect(2) = 1e-47 Identities = 83/120 (69%), Positives = 91/120 (75%) Frame = +2 Query: 20 MSIEGGSLLDSNXXXXXXYSGDRNENEYHDVXXXXXXXXXXXLKTWHHQFLKIDFKTIFM 199 MS EGGSLLDS + D+NENEYHDV LKTWHHQFLKIDF+ I Sbjct: 1 MSFEGGSLLDS--PLNDDFYDDKNENEYHDVSSSNRSISNSSLKTWHHQFLKIDFRII-- 56 Query: 200 QPNHERIPYKNTLLLRYITLELCITIHYTEIIIPLNQVRKFQLASNRNIYLELKKDFVRY 379 N+E++ K+ L+LRYITLELCITIHYTEIIIPLNQVRKFQLASNRNIYLELKKDFVRY Sbjct: 57 --NNEKMSQKSVLVLRYITLELCITIHYTEIIIPLNQVRKFQLASNRNIYLELKKDFVRY 114 Score = 59.3 bits (142), Expect(2) = 1e-47 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 384 YYNNPKGLIGTRIPISNDPTNVTEGE 461 YYNNPKGLIGTRIPISNDPTNVTEGE Sbjct: 115 YYNNPKGLIGTRIPISNDPTNVTEGE 140