BLASTX nr result
ID: Ophiopogon27_contig00054675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054675 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY48852.1| HIT-like protein [Rhizophagus irregularis] 275 9e-93 gb|EXX62844.1| Hnt1p [Rhizophagus irregularis DAOM 197198w] >gi|... 272 2e-91 gb|OZJ05227.1| hypothetical protein BZG36_02319 [Bifiguratus ade... 143 1e-40 gb|OGY43437.1| HIT family hydrolase [Candidatus Buchananbacteria... 135 5e-38 gb|OGY49241.1| hypothetical protein A3D39_03025 [Candidatus Buch... 133 4e-37 gb|AQQ72029.1| HIT-like protein [Phycisphaerae bacterium SM-Chi-D1] 128 5e-35 gb|OHB47625.1| HIT family hydrolase [Planctomycetes bacterium GW... 127 6e-35 ref|WP_090917609.1| MULTISPECIES: HIT family protein [Bacillus] ... 127 8e-35 ref|WP_016131213.1| MULTISPECIES: HIT family protein [Bacillus c... 127 1e-34 ref|WP_016113665.1| MULTISPECIES: HIT family protein [Bacillus c... 127 1e-34 gb|OQY98007.1| hypothetical protein B6D36_18145 [Planctomycetes ... 127 1e-34 ref|WP_063535828.1| HIT family protein [Bacillus cereus] >gi|102... 127 2e-34 ref|WP_019294226.1| HIT family protein [Lactococcus garvieae] >g... 126 2e-34 ref|WP_098378882.1| HIT family protein [Bacillus cereus] >gi|126... 126 2e-34 ref|WP_097899673.1| MULTISPECIES: HIT family protein [Bacillus] ... 126 2e-34 ref|WP_035437490.1| MULTISPECIES: HIT family protein [Bacillus] ... 126 2e-34 ref|WP_033673933.1| HIT family protein [Bacillus gaemokensis] >g... 126 2e-34 ref|WP_017152948.1| HIT family protein [Bacillus bingmayongensis] 126 2e-34 ref|WP_003195737.1| MULTISPECIES: HIT family protein [Bacillus] ... 126 2e-34 gb|KKR96872.1| Histidine triad (HIT) protein [Candidatus Magasan... 126 2e-34 >gb|PKY48852.1| HIT-like protein [Rhizophagus irregularis] Length = 168 Score = 275 bits (703), Expect = 9e-93 Identities = 141/158 (89%), Positives = 146/158 (92%), Gaps = 3/158 (1%) Frame = +3 Query: 3 LFPRTTL---RILSQPVNSNSPLSEDPKNCTFCKIISGQLPCVKIFENDEILAFLDVAPI 173 LFPR T R LS V SNS SEDPK+CTFCKI+SGQLPC+K+FENDEILAFLDVAPI Sbjct: 8 LFPRITPESPRNLSLNVKSNSVPSEDPKDCTFCKIVSGQLPCIKVFENDEILAFLDVAPI 67 Query: 174 SRGHTLVIPKTHIPRLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQVAGQV 353 SRGHTLVIPKTHI RLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQ+AGQV Sbjct: 68 SRGHTLVIPKTHISRLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQIAGQV 127 Query: 354 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR 467 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR Sbjct: 128 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR 165 >gb|EXX62844.1| Hnt1p [Rhizophagus irregularis DAOM 197198w] gb|PKC05344.1| HIT-like protein [Rhizophagus irregularis] gb|PKC68679.1| HIT-like protein [Rhizophagus irregularis] gb|PKK72516.1| HIT-like protein [Rhizophagus irregularis] gb|PKY19618.1| HIT-like protein [Rhizophagus irregularis] gb|POG73247.1| hypothetical protein GLOIN_2v1477034 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 168 Score = 272 bits (695), Expect = 2e-91 Identities = 140/158 (88%), Positives = 145/158 (91%), Gaps = 3/158 (1%) Frame = +3 Query: 3 LFPRTTL---RILSQPVNSNSPLSEDPKNCTFCKIISGQLPCVKIFENDEILAFLDVAPI 173 LFPR T R LS V SNS SED K+CTFCKI+SGQLPC+K+FENDEILAFLDVAPI Sbjct: 8 LFPRITPESPRNLSLNVKSNSVPSEDQKDCTFCKIVSGQLPCIKVFENDEILAFLDVAPI 67 Query: 174 SRGHTLVIPKTHIPRLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQVAGQV 353 SRGHTLVIPKTHI RLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQ+AGQV Sbjct: 68 SRGHTLVIPKTHISRLTLASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQIAGQV 127 Query: 354 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR 467 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR Sbjct: 128 VFHLHFHIIPRFKEVESRSGGRLRLSKDESEKIGKDIR 165 >gb|OZJ05227.1| hypothetical protein BZG36_02319 [Bifiguratus adelaidae] Length = 166 Score = 143 bits (360), Expect = 1e-40 Identities = 68/125 (54%), Positives = 91/125 (72%) Frame = +3 Query: 45 NSNSPLSEDPKNCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLT 224 N++ + + +C FCKI++ + P +FEN+ +LAFLD+ P+++GHTLVIPKTH LT Sbjct: 19 NASKCVITEEHDCIFCKIVARKAPANVVFENEHVLAFLDLQPLTKGHTLVIPKTHYKNLT 78 Query: 225 LASPSIMSSLGSVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVES 404 + P M+ L SVLP+I+NAV Q VGT D+NI+QNNG A QVVFHLHFHIIPRF V+ Sbjct: 79 VTPPEEMARLASVLPKIANAVTQAVGTSDYNIMQNNGAAALQVVFHLHFHIIPRF--VDQ 136 Query: 405 RSGGR 419 GG+ Sbjct: 137 PIGGK 141 >gb|OGY43437.1| HIT family hydrolase [Candidatus Buchananbacteria bacterium RIFCSPHIGHO2_01_FULL_39_14] Length = 146 Score = 135 bits (341), Expect = 5e-38 Identities = 60/130 (46%), Positives = 91/130 (70%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 +C FCKI++GQ+P KI+E+D++LAFLD+ PI+ GHTLVIPKTH LT + +L Sbjct: 5 DCIFCKIVAGQIPAAKIYEDDKVLAFLDINPINPGHTLVIPKTHFSNLTQTPVEVSQNLI 64 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVESRSGGRLRLSKD 437 V+ +IS A+++GVG + FN+ NNG +AGQ++FH+HFH+IPRF + + + Sbjct: 65 MVIKKISPAIMKGVGAQGFNLGLNNGSIAGQIIFHMHFHLIPRFADDGHKLWSGRQYQLG 124 Query: 438 ESEKIGKDIR 467 E EK+ ++I+ Sbjct: 125 EMEKVAENIK 134 >gb|OGY49241.1| hypothetical protein A3D39_03025 [Candidatus Buchananbacteria bacterium RIFCSPHIGHO2_02_FULL_39_17] Length = 146 Score = 133 bits (335), Expect = 4e-37 Identities = 59/130 (45%), Positives = 90/130 (69%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 +C FCKI++GQ+P KI+E+D++LAFLD+ PI+ GHTLVIPK H LT + +L Sbjct: 5 DCIFCKIVAGQIPAAKIYEDDKVLAFLDINPINPGHTLVIPKIHFSNLTQTPVEVSQNLI 64 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVESRSGGRLRLSKD 437 V+ +IS A+++GVG + FN+ NNG +AGQ++FH+HFH+IPRF + + + Sbjct: 65 MVIKKISPAIMKGVGAQGFNLGLNNGSIAGQIIFHMHFHLIPRFADDGHKLWSGRQYQLG 124 Query: 438 ESEKIGKDIR 467 E EK+ ++I+ Sbjct: 125 EMEKVAENIK 134 >gb|AQQ72029.1| HIT-like protein [Phycisphaerae bacterium SM-Chi-D1] Length = 140 Score = 128 bits (321), Expect = 5e-35 Identities = 57/103 (55%), Positives = 80/103 (77%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 +C FCKI +G++PC KI+E+D+ILAF+D+ PIS GH LVIPKTH R+ ++P +++ L Sbjct: 5 DCIFCKIAAGEIPCGKIYEDDDILAFMDINPISDGHILVIPKTHSARVHESNPDVLAKLA 64 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPR 386 + LP +++AVI+G+G +NIL NNG AGQ V H+HFHIIPR Sbjct: 65 AKLPLLASAVIKGLGCSGYNILCNNGAAAGQEVDHVHFHIIPR 107 >gb|OHB47625.1| HIT family hydrolase [Planctomycetes bacterium GWF2_41_51] Length = 135 Score = 127 bits (320), Expect = 6e-35 Identities = 53/103 (51%), Positives = 79/103 (76%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 +C FCKI +GQ+PC KI+E++ +LAFLD+ P+S GHTLVIPK H ++ +++ +G Sbjct: 2 DCIFCKIAAGQIPCEKIYEDENVLAFLDIGPLSEGHTLVIPKQHFTKIHECPAQLLAQIG 61 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPR 386 SVLP+++ AV +G+ + +N+L NNG+ AGQ+V H+HFHIIPR Sbjct: 62 SVLPKVAGAVFKGMTSDGYNVLCNNGKAAGQLVEHIHFHIIPR 104 >ref|WP_090917609.1| MULTISPECIES: HIT family protein [Bacillus] emb|SFS68500.1| histidine triad (HIT) family protein [Bacillus sp. 103mf] emb|SFJ58034.1| histidine triad (HIT) family protein [Bacillus sp. 71mf] Length = 144 Score = 127 bits (320), Expect = 8e-35 Identities = 55/106 (51%), Positives = 77/106 (72%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I + + Sbjct: 7 NCIFCKIIEGQIPCAKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDVFALTPEIATHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ FN+L NNG+ AGQ VFH HFH+IPR+ E Sbjct: 67 SVVPKISNAIKTEYNPVGFNLLNNNGEKAGQTVFHFHFHLIPRYGE 112 >ref|WP_016131213.1| MULTISPECIES: HIT family protein [Bacillus cereus group] gb|EOP75407.1| hit-like cell-cycle regulation protein [Bacillus cereus VDM006] gb|EOQ15207.1| hit-like cell-cycle regulation protein [Bacillus cereus VDM021] gb|OUM48372.1| HIT family protein [Bacillus pseudomycoides] gb|PEK69998.1| HIT family protein [Bacillus pseudomycoides] gb|PGE86713.1| HIT family protein [Bacillus pseudomycoides] Length = 144 Score = 127 bits (319), Expect = 1e-34 Identities = 55/106 (51%), Positives = 77/106 (72%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ + FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKSEFNSVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >ref|WP_016113665.1| MULTISPECIES: HIT family protein [Bacillus cereus group] gb|EOP57959.1| hit-like cell-cycle regulation protein [Bacillus cereus VD136] gb|OOG90235.1| hypothetical protein BTH41_03405 [Bacillus mycoides] gb|PDY44265.1| HIT family protein [Bacillus pseudomycoides] gb|PEA81927.1| HIT family protein [Bacillus pseudomycoides] gb|PED06692.1| HIT family protein [Bacillus pseudomycoides] gb|PED70488.1| HIT family protein [Bacillus pseudomycoides] gb|PEI44234.1| HIT family protein [Bacillus pseudomycoides] gb|PEI90972.1| HIT family protein [Bacillus pseudomycoides] gb|PEI93422.1| HIT family protein [Bacillus pseudomycoides] gb|PEJ70453.1| HIT family protein [Bacillus pseudomycoides] gb|PEK16982.1| HIT family protein [Bacillus pseudomycoides] gb|PEL22545.1| HIT family protein [Bacillus pseudomycoides] gb|PEM15388.1| HIT family protein [Bacillus pseudomycoides] gb|PEM74366.1| HIT family protein [Bacillus pseudomycoides] gb|PEO21836.1| HIT family protein [Bacillus pseudomycoides] gb|PEO96423.1| HIT family protein [Bacillus pseudomycoides] gb|PEP53844.1| HIT family protein [Bacillus pseudomycoides] gb|PFW67009.1| HIT family protein [Bacillus pseudomycoides] gb|PFW69721.1| HIT family protein [Bacillus pseudomycoides] gb|PFZ42739.1| HIT family protein [Bacillus pseudomycoides] gb|PGA15393.1| HIT family protein [Bacillus pseudomycoides] gb|PGA60481.1| HIT family protein [Bacillus pseudomycoides] gb|PGC42388.1| HIT family protein [Bacillus pseudomycoides] gb|PGD19659.1| HIT family protein [Bacillus pseudomycoides] gb|PGD24022.1| HIT family protein [Bacillus pseudomycoides] gb|PHA47888.1| HIT family protein [Bacillus pseudomycoides] gb|PHA52275.1| HIT family protein [Bacillus pseudomycoides] gb|PHB16936.1| HIT family protein [Bacillus pseudomycoides] gb|PHB48059.1| HIT family protein [Bacillus pseudomycoides] gb|PHB71066.1| HIT family protein [Bacillus pseudomycoides] gb|PHC47656.1| HIT family protein [Bacillus pseudomycoides] gb|PHE49787.1| HIT family protein [Bacillus pseudomycoides] Length = 144 Score = 127 bits (319), Expect = 1e-34 Identities = 55/106 (51%), Positives = 77/106 (72%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ + FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKSEFNSVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >gb|OQY98007.1| hypothetical protein B6D36_18145 [Planctomycetes bacterium UTPLA1] Length = 140 Score = 127 bits (318), Expect = 1e-34 Identities = 54/106 (50%), Positives = 78/106 (73%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKI SGQ+P +++FE+D+ +AFLD+AP++ GHTL+IPK+H L ASP ++ L Sbjct: 4 NCIFCKIASGQIPSLRVFESDDAVAFLDIAPLAPGHTLLIPKSHCSSLLEASPELLGRLT 63 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 LP ++ AV++ G N+LQN+G+ +GQ VFHLHFH+IPR + Sbjct: 64 MHLPSLARAVLKSTGATGLNVLQNSGESSGQAVFHLHFHLIPRVSD 109 >ref|WP_063535828.1| HIT family protein [Bacillus cereus] gb|ANC18197.1| protein hit [Bacillus cereus] Length = 144 Score = 127 bits (318), Expect = 2e-34 Identities = 55/106 (51%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++EN+ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIDGQIPCSKVYENEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+I+NA+ FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >ref|WP_019294226.1| HIT family protein [Lactococcus garvieae] gb|OAL08013.1| hypothetical protein A7X72_01746 [Lactococcus garvieae] Length = 131 Score = 126 bits (316), Expect = 2e-34 Identities = 54/106 (50%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII+G++P KI+E+D ++AFLD+ ++GHTLV+PKTH L +P S L Sbjct: 3 NCIFCKIIAGEIPSTKIYEDDNLVAFLDITQTTKGHTLVVPKTHTRNLLAMAPEQASQLF 62 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 S +P+I+N ++ +G K NILQNN ++AGQ VFH H H+IPR+ E Sbjct: 63 SKIPEIANKLVDSLGAKGMNILQNNEEIAGQTVFHTHVHLIPRYAE 108 >ref|WP_098378882.1| HIT family protein [Bacillus cereus] gb|PFA89605.1| HIT family protein [Bacillus cereus] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/109 (50%), Positives = 78/109 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIDGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVES 404 SV+P+I+NA+ FN+L NNG+ AGQ VFH H H+IPR+ E +S Sbjct: 67 SVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGEKDS 115 >ref|WP_097899673.1| MULTISPECIES: HIT family protein [Bacillus] gb|PEB47812.1| HIT family protein [Bacillus sp. AFS098217] gb|PED82673.1| HIT family protein [Bacillus pseudomycoides] gb|PEU12723.1| HIT family protein [Bacillus sp. AFS014408] gb|PEU13682.1| HIT family protein [Bacillus sp. AFS019443] gb|PFW60113.1| HIT family protein [Bacillus sp. AFS075034] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/109 (50%), Positives = 78/109 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVES 404 SV+P+I+NA+ FN+L NNG+ AGQ VFH H H+IPR+ E +S Sbjct: 67 SVVPKIANAIKSEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGENDS 115 >ref|WP_035437490.1| MULTISPECIES: HIT family protein [Bacillus] emb|SFC26070.1| histidine triad (HIT) family protein [Bacillus sp. 491mf] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/106 (51%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCAKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDVFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKTEYNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >ref|WP_033673933.1| HIT family protein [Bacillus gaemokensis] gb|KEK24923.1| protein hit [Bacillus gaemokensis] gb|KYG30233.1| protein hit [Bacillus gaemokensis] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/106 (51%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKSEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >ref|WP_017152948.1| HIT family protein [Bacillus bingmayongensis] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/106 (51%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKSEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >ref|WP_003195737.1| MULTISPECIES: HIT family protein [Bacillus] gb|EEM06587.1| Histidine triad (HIT) protein [Bacillus mycoides Rock1-4] gb|EEM12407.1| Histidine triad (HIT) protein [Bacillus mycoides Rock3-17] gb|EEM18175.1| Histidine triad (HIT) protein [Bacillus pseudomycoides DSM 12442] gb|AIK40780.1| protein hit [Bacillus mycoides] gb|KFN14819.1| protein hit [Bacillus mycoides] gb|AJI16644.1| protein hit [Bacillus mycoides] gb|OOR51482.1| HIT family protein [Bacillus pseudomycoides] gb|PDX98174.1| HIT family protein [Bacillus pseudomycoides] gb|PDY11535.1| HIT family protein [Bacillus pseudomycoides] gb|PDZ13122.1| HIT family protein [Bacillus pseudomycoides] gb|PDZ71887.1| HIT family protein [Bacillus pseudomycoides] gb|PEB40804.1| HIT family protein [Bacillus pseudomycoides] gb|PEE06369.1| HIT family protein [Bacillus pseudomycoides] gb|PEF21658.1| HIT family protein [Bacillus pseudomycoides] gb|PEF73362.1| HIT family protein [Bacillus pseudomycoides] gb|PEI39979.1| HIT family protein [Bacillus pseudomycoides] gb|PEJ21407.1| HIT family protein [Bacillus pseudomycoides] gb|PEJ31454.1| HIT family protein [Bacillus pseudomycoides] gb|PEK38210.1| HIT family protein [Bacillus pseudomycoides] gb|PEK70254.1| HIT family protein [Bacillus pseudomycoides] gb|PEK77974.1| HIT family protein [Bacillus pseudomycoides] gb|PEL81354.1| HIT family protein [Bacillus pseudomycoides] gb|PEM36913.1| HIT family protein [Bacillus pseudomycoides] gb|PEM71240.1| HIT family protein [Bacillus pseudomycoides] gb|PEM78460.1| HIT family protein [Bacillus pseudomycoides] gb|PEN03378.1| HIT family protein [Bacillus pseudomycoides] gb|PEO43149.1| HIT family protein [Bacillus pseudomycoides] gb|PEO86037.1| HIT family protein [Bacillus pseudomycoides] gb|PEP42789.1| HIT family protein [Bacillus pseudomycoides] gb|PEP44908.1| HIT family protein [Bacillus pseudomycoides] gb|PEP54108.1| HIT family protein [Bacillus pseudomycoides] gb|PEP80938.1| HIT family protein [Bacillus pseudomycoides] gb|PEU49212.1| HIT family protein [Bacillus pseudomycoides] gb|PFW89311.1| HIT family protein [Bacillus pseudomycoides] gb|PFX44794.1| HIT family protein [Bacillus pseudomycoides] gb|PFX61018.1| HIT family protein [Bacillus pseudomycoides] gb|PFY15480.1| HIT family protein [Bacillus pseudomycoides] gb|PFY61847.1| HIT family protein [Bacillus pseudomycoides] gb|PFY90745.1| HIT family protein [Bacillus pseudomycoides] gb|PFZ05245.1| HIT family protein [Bacillus pseudomycoides] gb|PFZ11331.1| HIT family protein [Bacillus pseudomycoides] gb|PFZ80815.1| HIT family protein [Bacillus pseudomycoides] gb|PFZ91626.1| HIT family protein [Bacillus pseudomycoides] gb|PGA72493.1| HIT family protein [Bacillus pseudomycoides] gb|PGA75700.1| HIT family protein [Bacillus pseudomycoides] gb|PGB76208.1| HIT family protein [Bacillus pseudomycoides] gb|PGC29542.1| HIT family protein [Bacillus pseudomycoides] gb|PGC43243.1| HIT family protein [Bacillus pseudomycoides] gb|PGD77803.1| HIT family protein [Bacillus pseudomycoides] gb|PGD94136.1| HIT family protein [Bacillus pseudomycoides] gb|PGE05143.1| HIT family protein [Bacillus pseudomycoides] gb|PGE17952.1| HIT family protein [Bacillus pseudomycoides] gb|PGE29494.1| HIT family protein [Bacillus pseudomycoides] gb|PGE96322.1| HIT family protein [Bacillus pseudomycoides] gb|PGF08829.1| HIT family protein [Bacillus pseudomycoides] gb|PGS05144.1| HIT family protein [Bacillus mycoides] gb|PHA94148.1| HIT family protein [Bacillus pseudomycoides] gb|PHB30674.1| HIT family protein [Bacillus pseudomycoides] gb|PHC35052.1| HIT family protein [Bacillus pseudomycoides] gb|PHC75497.1| HIT family protein [Bacillus pseudomycoides] gb|PHC81001.1| HIT family protein [Bacillus pseudomycoides] gb|PHC82429.1| HIT family protein [Bacillus pseudomycoides] gb|PHD16427.1| HIT family protein [Bacillus pseudomycoides] gb|PHE21150.1| HIT family protein [Bacillus pseudomycoides] gb|PHE41000.1| HIT family protein [Bacillus pseudomycoides] gb|PHE56353.1| HIT family protein [Bacillus pseudomycoides] gb|PHE68336.1| HIT family protein [Bacillus pseudomycoides] gb|PHE92224.1| HIT family protein [Bacillus pseudomycoides] gb|PHF03048.1| HIT family protein [Bacillus pseudomycoides] gb|PHG20772.1| HIT family protein [Bacillus pseudomycoides] gb|PHG28287.1| HIT family protein [Bacillus pseudomycoides] Length = 144 Score = 126 bits (317), Expect = 2e-34 Identities = 55/106 (51%), Positives = 76/106 (71%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 NC FCKII GQ+PC K++E++ +LAFLD++ +++GHTLVIPK H + +P I S + Sbjct: 7 NCIFCKIIEGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTPEIASHIF 66 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKE 395 SV+P+ISNA+ FN+L NNG+ AGQ VFH H H+IPR+ E Sbjct: 67 SVVPKISNAIKSEFNPVGFNLLNNNGEKAGQTVFHFHLHLIPRYGE 112 >gb|KKR96872.1| Histidine triad (HIT) protein [Candidatus Magasanikbacteria bacterium GW2011_GWC2_41_17] Length = 135 Score = 126 bits (316), Expect = 2e-34 Identities = 56/130 (43%), Positives = 86/130 (66%) Frame = +3 Query: 78 NCTFCKIISGQLPCVKIFENDEILAFLDVAPISRGHTLVIPKTHIPRLTLASPSIMSSLG 257 +C FCKII G+LPCVK++E+ EI+AFLD+ P++ GHTLV+PK H + ++S L Sbjct: 3 DCIFCKIIKGELPCVKVYEDSEIMAFLDIHPVNFGHTLVVPKAHYVNVMDTPADLLSKLM 62 Query: 258 SVLPQISNAVIQGVGTKDFNILQNNGQVAGQVVFHLHFHIIPRFKEVESRSGGRLRLSKD 437 +V+ +I+ A+ + GT FN+ NNG AGQV+FH HFH++PR+ + G + Sbjct: 63 TVVKKIAPAISKATGTDSFNLGVNNGSPAGQVIFHTHFHVMPRYDGDGYKMWGAKAYAPG 122 Query: 438 ESEKIGKDIR 467 E EK+G+ ++ Sbjct: 123 EMEKLGEAVK 132