BLASTX nr result
ID: Ophiopogon27_contig00054613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054613 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK68230.1| uncharacterized protein A4U43_C05F9050 [Asparagus... 72 2e-13 >gb|ONK68230.1| uncharacterized protein A4U43_C05F9050 [Asparagus officinalis] Length = 120 Score = 71.6 bits (174), Expect = 2e-13 Identities = 34/67 (50%), Positives = 45/67 (67%) Frame = -3 Query: 391 CSYRKPVDGDDNFASGSEIPVKLAPLERESLVTVVIMAGDDEPSYLAKPYDVLKDSARIA 212 CS K DGD+N S E P ++P+ERE+ V VVIMAGDDEP++LAKPYDV ++ + Sbjct: 37 CSDHKSSDGDENSRSQPEAPAAVSPVEREAKVMVVIMAGDDEPTFLAKPYDVEPTTSVVV 96 Query: 211 PLQSSGY 191 + GY Sbjct: 97 DVAEEGY 103