BLASTX nr result
ID: Ophiopogon27_contig00054415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054415 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KLL03768.1| adenine-specific DNA methylase [Mycoplasmataceae ... 55 3e-06 >gb|KLL03768.1| adenine-specific DNA methylase [Mycoplasmataceae bacterium CE_OT135] Length = 222 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 405 LKTVDLLI*IKPHFGFGAYFHQQAEFAFLIQK 310 LK VDLLI KPHFGFG+YF QAEFAFLIQK Sbjct: 90 LKIVDLLIWAKPHFGFGSYFRNQAEFAFLIQK 121