BLASTX nr result
ID: Ophiopogon27_contig00054345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054345 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC20197.1| hypothetical protein RIR_0762300 [Rhizophagus ir... 60 2e-08 gb|PKC14074.1| hypothetical protein RhiirA5_495668 [Rhizophagus ... 59 5e-08 gb|PKY36593.1| hypothetical protein RhiirB3_459579 [Rhizophagus ... 57 5e-08 gb|PKC55680.1| hypothetical protein RhiirA1_542421 [Rhizophagus ... 59 1e-07 gb|PKC67650.1| hypothetical protein RhiirA1_534758 [Rhizophagus ... 59 1e-07 dbj|GBC32937.1| hypothetical protein RIR_1794000 [Rhizophagus ir... 58 3e-07 dbj|GBC50070.1| hypothetical protein RIR_3184600 [Rhizophagus ir... 58 3e-07 gb|PKB95629.1| hypothetical protein RhiirA5_507235 [Rhizophagus ... 56 9e-07 gb|EXX65681.1| hypothetical protein RirG_130920 [Rhizophagus irr... 56 9e-07 gb|PKC66336.1| hypothetical protein RhiirA1_459874 [Rhizophagus ... 39 5e-06 gb|PKC00038.1| hypothetical protein RhiirA5_428786 [Rhizophagus ... 39 5e-06 >dbj|GBC20197.1| hypothetical protein RIR_0762300 [Rhizophagus irregularis DAOM 181602] Length = 127 Score = 60.1 bits (144), Expect = 2e-08 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G+KYYE+F+++F Sbjct: 42 LEFRTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGMKYYEEFSEHF 94 >gb|PKC14074.1| hypothetical protein RhiirA5_495668 [Rhizophagus irregularis] Length = 101 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 42 LEFRTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 94 >gb|PKY36593.1| hypothetical protein RhiirB3_459579 [Rhizophagus irregularis] Length = 67 Score = 57.4 bits (137), Expect = 5e-08 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF SL R YK M+ YIDG+ + G KYYE+F++ F Sbjct: 15 LEFGTTYTGRQCKEKFNSLVRAYKKMQLYIDGQPKGRSSALGAKYYEEFSERF 67 >gb|PKC55680.1| hypothetical protein RhiirA1_542421 [Rhizophagus irregularis] Length = 136 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 15 LEFRTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 67 >gb|PKC67650.1| hypothetical protein RhiirA1_534758 [Rhizophagus irregularis] Length = 149 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 15 LEFRTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 67 >dbj|GBC32937.1| hypothetical protein RIR_1794000 [Rhizophagus irregularis DAOM 181602] Length = 167 Score = 57.8 bits (138), Expect(2) = 3e-07 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 42 LEFGTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 94 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 440 KRNFWKQVSMKINL 399 K NFWK ++ KINL Sbjct: 29 KHNFWKGLASKINL 42 >dbj|GBC50070.1| hypothetical protein RIR_3184600 [Rhizophagus irregularis DAOM 181602] Length = 167 Score = 57.8 bits (138), Expect(2) = 3e-07 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L R YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 42 LEFGTTYTGRQCKEKFNGLVRAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 94 Score = 24.3 bits (51), Expect(2) = 3e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 440 KRNFWKQVSMKINL 399 K NFWK ++ KINL Sbjct: 29 KHNFWKGLASKINL 42 >gb|PKB95629.1| hypothetical protein RhiirA5_507235 [Rhizophagus irregularis] Length = 148 Score = 56.2 bits (134), Expect = 9e-07 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQ 241 L+F T Y+G C EKF L R YK M+ YIDG+ ++ G KYYE+F+Q Sbjct: 42 LEFRTTYTGRQCKEKFNGLVRAYKKMQLYIDGQPKGKRSALGAKYYEEFSQ 92 >gb|EXX65681.1| hypothetical protein RirG_130920 [Rhizophagus irregularis DAOM 197198w] dbj|GBC42655.1| hypothetical protein RIR_2581200 [Rhizophagus irregularis DAOM 181602] Length = 168 Score = 56.2 bits (134), Expect(2) = 9e-07 Identities = 25/53 (47%), Positives = 34/53 (64%) Frame = -1 Query: 393 LQFETCYSGAHCMEKFESLKRDYKCMKAYIDGKDNRNKTKNGLKYYEKFNQNF 235 L+F T Y+G C EKF L + YK M+ YI+GK K+ G KYYE+F++ F Sbjct: 42 LEFGTTYTGRQCKEKFNGLVQAYKKMQLYIEGKPKGRKSALGTKYYEEFSERF 94 Score = 24.3 bits (51), Expect(2) = 9e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 440 KRNFWKQVSMKINL 399 K NFWK ++ KINL Sbjct: 29 KHNFWKGLASKINL 42 >gb|PKC66336.1| hypothetical protein RhiirA1_459874 [Rhizophagus irregularis] Length = 272 Score = 38.5 bits (88), Expect(3) = 5e-06 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = -3 Query: 253 EI*SEFWKRPVTEYDRLREQNIARRYQTPPPHTKKMEVLLYRNHNHNCYKN 101 E S+FWK+PVT+YD+L +N+A Q K +LL NH+ Y + Sbjct: 215 EFSSKFWKKPVTKYDKLHFKNMA--MQAEKEKAAKTLLLLSEEGNHHYYND 263 Score = 32.7 bits (73), Expect(3) = 5e-06 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 309 YIDGKDNRNKTKNGLKYYEKFNQNFGK 229 Y G + KT+NG KYYE+F+ F K Sbjct: 196 YTGGNEKGKKTRNGEKYYEEFSSKFWK 222 Score = 25.8 bits (55), Expect(3) = 5e-06 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 443 GKRNFWKQVSMKINL 399 GK+ FWK+++ KINL Sbjct: 176 GKKMFWKELASKINL 190 >gb|PKC00038.1| hypothetical protein RhiirA5_428786 [Rhizophagus irregularis] Length = 256 Score = 38.5 bits (88), Expect(3) = 5e-06 Identities = 20/51 (39%), Positives = 29/51 (56%) Frame = -3 Query: 253 EI*SEFWKRPVTEYDRLREQNIARRYQTPPPHTKKMEVLLYRNHNHNCYKN 101 E S+FWK+PVT+YD+L +N+A Q K +LL NH+ Y + Sbjct: 199 EFSSKFWKKPVTKYDKLHFKNMA--MQAEKEKAAKTLLLLSEEGNHHYYND 247 Score = 32.7 bits (73), Expect(3) = 5e-06 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 309 YIDGKDNRNKTKNGLKYYEKFNQNFGK 229 Y G + KT+NG KYYE+F+ F K Sbjct: 180 YTGGNEKGKKTRNGEKYYEEFSSKFWK 206 Score = 25.8 bits (55), Expect(3) = 5e-06 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 443 GKRNFWKQVSMKINL 399 GK+ FWK+++ KINL Sbjct: 160 GKKMFWKELASKINL 174