BLASTX nr result
ID: Ophiopogon27_contig00054335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054335 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX74071.1| hypothetical protein RirG_054460 [Rhizophagus irr... 100 1e-24 >gb|EXX74071.1| hypothetical protein RirG_054460 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41781.1| JEMT01013268.1_cds_EXX74071.1_5955 [Rhizophagus irregularis DAOM 181602] gb|PKC10197.1| hypothetical protein RhiirA5_414661 [Rhizophagus irregularis] gb|PKC75681.1| hypothetical protein RhiirA1_528640 [Rhizophagus irregularis] gb|PKK78481.1| hypothetical protein RhiirC2_770175 [Rhizophagus irregularis] gb|PKY12790.1| hypothetical protein RhiirB3_518289 [Rhizophagus irregularis] gb|PKY39495.1| hypothetical protein RhiirA4_538155 [Rhizophagus irregularis] gb|POG70256.1| hypothetical protein GLOIN_2v1617799 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 97 Score = 100 bits (248), Expect = 1e-24 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 238 TCYWGQGRCWLDTNHGHFLETRTIHSLTSSSNEMASGNLLDKSGVTA 98 TCYWGQGRCWLDTNHGHFLE RTIHSLTSSSNEMASGNLL+KSG+TA Sbjct: 51 TCYWGQGRCWLDTNHGHFLEPRTIHSLTSSSNEMASGNLLNKSGMTA 97