BLASTX nr result
ID: Ophiopogon27_contig00054266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054266 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276434.1| UPF0481 protein At3g47200-like [Asparagus of... 55 4e-06 gb|ONK64977.1| uncharacterized protein A4U43_C07F32100 [Asparagu... 55 4e-06 >ref|XP_020276434.1| UPF0481 protein At3g47200-like [Asparagus officinalis] Length = 486 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 2 LADVFIQVKKYHGSSWRRWRAQLIHNYFIHPWA 100 L DVF++VKKYH S W RWRA LI +YF +PWA Sbjct: 425 LGDVFVKVKKYHESKWHRWRAGLIRDYFSNPWA 457 >gb|ONK64977.1| uncharacterized protein A4U43_C07F32100 [Asparagus officinalis] Length = 621 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 2 LADVFIQVKKYHGSSWRRWRAQLIHNYFIHPWA 100 L DVF++VKKYH S W RWRA LI +YF +PWA Sbjct: 425 LGDVFVKVKKYHESKWHRWRAGLIRDYFSNPWA 457