BLASTX nr result
ID: Ophiopogon27_contig00054239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054239 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKB99785.1| hypothetical protein RhiirA5_505541 [Rhizophagus ... 42 4e-06 gb|PKY32567.1| hypothetical protein RhiirB3_450842 [Rhizophagus ... 44 7e-06 >gb|PKB99785.1| hypothetical protein RhiirA5_505541 [Rhizophagus irregularis] Length = 400 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 68 QGVDRVFEIVTDTSEWYFMECS 3 Q V+RVF IVTD SEWYFMECS Sbjct: 324 QDVNRVFGIVTDASEWYFMECS 345 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 28/84 (33%), Positives = 35/84 (41%), Gaps = 22/84 (26%) Frame = -2 Query: 264 KYFMSSYSCQPPFRKHQQGIWVTKIIYSYCYLA----------------------RV*RK 151 KY M+ + + TK IYSYCYLA K Sbjct: 239 KYLMAEIKLRQDVTPLNKANEATKSIYSYCYLASGISLYKDNFKLIPEKLIEVKKEDFMK 298 Query: 150 TTIRPSVQMELTLTRKCKADKIDS 79 + SVQME TL+RK KAD+ID+ Sbjct: 299 GFAQASVQMESTLSRKRKADEIDN 322 >gb|PKY32567.1| hypothetical protein RhiirB3_450842 [Rhizophagus irregularis] Length = 431 Score = 43.9 bits (102), Expect(2) = 7e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 68 QGVDRVFEIVTDTSEWYFMECS 3 Q VDRVF IVTD SEWYFMECS Sbjct: 319 QDVDRVFGIVTDASEWYFMECS 340 Score = 33.5 bits (75), Expect(2) = 7e-06 Identities = 25/61 (40%), Positives = 31/61 (50%), Gaps = 21/61 (34%) Frame = -2 Query: 198 TKIIYSYCYLA----------RV*RKTTIR-----------PSVQMELTLTRKCKADKID 82 TK IYSYCYLA ++ + I SVQME TL+RK KAD+ID Sbjct: 257 TKSIYSYCYLASGVSLYKDNFKLIPEKLIEGRNGQGNLDYAASVQMESTLSRKRKADEID 316 Query: 81 S 79 + Sbjct: 317 N 317