BLASTX nr result
ID: Ophiopogon27_contig00054149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00054149 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX62018.1| hypothetical protein RirG_165530 [Rhizophagus irr... 78 3e-14 >gb|EXX62018.1| hypothetical protein RirG_165530 [Rhizophagus irregularis DAOM 197198w] dbj|GBC48889.1| mediator of RNA polymerase II transcription subunit 25-like isoform x7 [Rhizophagus irregularis DAOM 181602] gb|PKC69292.1| hypothetical protein RhiirA1_504813 [Rhizophagus irregularis] Length = 937 Score = 78.2 bits (191), Expect = 3e-14 Identities = 40/53 (75%), Positives = 45/53 (84%), Gaps = 3/53 (5%) Frame = +1 Query: 1 KKLAAFVRFPNAPNPNGGLVLFTNTTNGP---SKLVGLLFLDMPLPLSSPVAS 150 +K+AAFVRFPNAPNPNGG+VLFTN NGP +KLVGLLFLD PLP S+PV S Sbjct: 745 RKMAAFVRFPNAPNPNGGIVLFTN--NGPGNATKLVGLLFLDTPLPTSAPVLS 795