BLASTX nr result
ID: Ophiopogon27_contig00053965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053965 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC21218.1| hypothetical protein RIR_0846900 [Rhizophagus ir... 73 3e-14 >dbj|GBC21218.1| hypothetical protein RIR_0846900 [Rhizophagus irregularis DAOM 181602] Length = 74 Score = 73.2 bits (178), Expect = 3e-14 Identities = 39/49 (79%), Positives = 39/49 (79%), Gaps = 8/49 (16%) Frame = +3 Query: 273 MNSIATNVIISKGK--------EDNPLLFLLHHEHRQKNIFASIDLKVD 395 MNSIATNVIISKGK EDNPLLFLLHHEHRQKN FASID KVD Sbjct: 1 MNSIATNVIISKGKIIKSIHHKEDNPLLFLLHHEHRQKNTFASIDPKVD 49