BLASTX nr result
ID: Ophiopogon27_contig00053899
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053899 (663 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010941839.1| PREDICTED: LOB domain-containing protein 36-... 61 3e-07 >ref|XP_010941839.1| PREDICTED: LOB domain-containing protein 36-like [Elaeis guineensis] Length = 316 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/64 (51%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -1 Query: 663 AKKELATFVGPAALGPFLP---PHHSPYXXXXXXXXXXXXFLGASGSSVQPSFAVPGMGM 493 AKKEL+ ++GPAALGPFLP PHH F GAS S+ QP F +PGMGM Sbjct: 103 AKKELSAYIGPAALGPFLPQPGPHHPAALVGGSHHHPQYQFQGASSSNAQP-FGMPGMGM 161 Query: 492 GLGL 481 G+G+ Sbjct: 162 GMGM 165