BLASTX nr result
ID: Ophiopogon27_contig00053808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053808 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16537.1| Tis13_338022 [Rhizophagus irregularis DAOM 18160... 52 5e-06 >dbj|GBC16537.1| Tis13_338022 [Rhizophagus irregularis DAOM 181602] gb|PKC14527.1| hypothetical protein RhiirA5_350221 [Rhizophagus irregularis] Length = 65 Score = 51.6 bits (122), Expect = 5e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 332 ISNVVVKNVLTENNLSFHKTISDYGGYETNFYQEKVS 442 ISNV +V TENNLSFHKTIS YGGY + YQEKVS Sbjct: 31 ISNV---DVSTENNLSFHKTISGYGGYRKSSYQEKVS 64