BLASTX nr result
ID: Ophiopogon27_contig00053793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053793 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC76259.1| hypothetical protein RhiirA1_406534 [Rhizophagus ... 66 5e-11 gb|EXX58236.1| hypothetical protein RirG_199990 [Rhizophagus irr... 66 2e-09 dbj|GBC49079.1| btb/poz domain-containing protein 19-like [Rhizo... 56 5e-06 >gb|PKC76259.1| hypothetical protein RhiirA1_406534 [Rhizophagus irregularis] Length = 87 Score = 65.9 bits (159), Expect = 5e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 539 KTNYAKITAYRTSYSKYATKPDAFKRVMIGP 447 KTNYAKITAY+TSYSKYATKPDAFKRVMIGP Sbjct: 57 KTNYAKITAYKTSYSKYATKPDAFKRVMIGP 87 >gb|EXX58236.1| hypothetical protein RirG_199990 [Rhizophagus irregularis DAOM 197198w] gb|POG70035.1| hypothetical protein GLOIN_2v1479513 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 332 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 539 KTNYAKITAYRTSYSKYATKPDAFKRVMIGP 447 KTNYAKITAY+TSYSKYATKPDAFKRVMIGP Sbjct: 302 KTNYAKITAYKTSYSKYATKPDAFKRVMIGP 332 >dbj|GBC49079.1| btb/poz domain-containing protein 19-like [Rhizophagus irregularis DAOM 181602] Length = 343 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 539 KTNYAKITAYRTSYSKYATKPDAFKRV 459 KTNYAKITAY+TSYSKYATKPDAFKR+ Sbjct: 302 KTNYAKITAYKTSYSKYATKPDAFKRL 328