BLASTX nr result
ID: Ophiopogon27_contig00053779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053779 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY55713.1| hypothetical protein RhiirA4_475356 [Rhizophagus ... 69 1e-10 gb|EXX72366.1| hypothetical protein RirG_069990 [Rhizophagus irr... 59 1e-08 gb|PKB99211.1| hypothetical protein RhiirA5_462455 [Rhizophagus ... 59 6e-07 gb|PKY42410.1| hypothetical protein RhiirA4_505278 [Rhizophagus ... 59 6e-07 gb|PKY61066.1| hypothetical protein RhiirA4_431570 [Rhizophagus ... 58 1e-06 gb|PKY53879.1| hypothetical protein RhiirA4_426357 [Rhizophagus ... 57 2e-06 gb|PKB96744.1| hypothetical protein RhiirA5_385130, partial [Rhi... 53 6e-06 gb|PKY34099.1| hypothetical protein RhiirB3_475917 [Rhizophagus ... 55 9e-06 gb|PKC55363.1| hypothetical protein RhiirA1_475738 [Rhizophagus ... 55 9e-06 gb|PKC08928.1| hypothetical protein RhiirA5_416330, partial [Rhi... 55 9e-06 >gb|PKY55713.1| hypothetical protein RhiirA4_475356 [Rhizophagus irregularis] Length = 637 Score = 68.9 bits (167), Expect = 1e-10 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +IE F ELP YQTSE FSI QF+LKTFVNVNDK+ + QAFESH KT Sbjct: 28 LIESFDELPSYQTSENFSIPQFELKTFVNVNDKERVHEWFQAFESHSKT 76 >gb|EXX72366.1| hypothetical protein RirG_069990 [Rhizophagus irregularis DAOM 197198w] dbj|GBC16812.1| JEMT01015495.1_cds_EXX72366.1_7664: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 65 Score = 58.5 bits (140), Expect = 1e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAY 342 +IE F ELPFYQTSE FSISQF+LKTFV+VNDK+ + Sbjct: 28 LIESFDELPFYQTSENFSISQFELKTFVDVNDKERVH 64 >gb|PKB99211.1| hypothetical protein RhiirA5_462455 [Rhizophagus irregularis] Length = 664 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +I+ F ELP YQTSE FSI QF+L FV++NDK+ A AFESH KT Sbjct: 31 LIKNFNELPPYQTSENFSIPQFELDAFVDINDKEKAQEWFLAFESHTKT 79 >gb|PKY42410.1| hypothetical protein RhiirA4_505278 [Rhizophagus irregularis] Length = 1527 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +I+ F ELP YQTSE F I QF+L FV+VNDK+ AY AFES KT Sbjct: 747 LIKNFNELPIYQTSENFQIPQFELDAFVDVNDKEEAYKWFLAFESQSKT 795 >gb|PKY61066.1| hypothetical protein RhiirA4_431570 [Rhizophagus irregularis] Length = 443 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +I+ F ELP YQTSE FSI QF+L FV++NDK+ A AF+SH KT Sbjct: 31 LIKNFKELPSYQTSENFSIPQFELDAFVDINDKEKAQEWFLAFKSHTKT 79 >gb|PKY53879.1| hypothetical protein RhiirA4_426357 [Rhizophagus irregularis] Length = 812 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +I+ F ELP Y+TSE FSI QF+L FV++NDK+ A + FESH KT Sbjct: 31 LIKNFNELPSYRTSENFSIPQFELDAFVDINDKEKAQEWFKVFESHTKT 79 >gb|PKB96744.1| hypothetical protein RhiirA5_385130, partial [Rhizophagus irregularis] Length = 124 Score = 53.1 bits (126), Expect = 6e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAY 342 +IE F ELP YQTSE F ISQF+LKTFV+VNDK+ + Sbjct: 87 LIESFDELPSYQTSENFLISQFELKTFVDVNDKERVH 123 >gb|PKY34099.1| hypothetical protein RhiirB3_475917 [Rhizophagus irregularis] Length = 281 Score = 54.7 bits (130), Expect = 9e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +IEKF ELP Y+T+E F+++QF+LK +VNV++K+ A+ AF+S KT Sbjct: 29 LIEKFSELPSYRTAENFNVTQFELKAYVNVDNKEEAHKWFAAFKSWSKT 77 >gb|PKC55363.1| hypothetical protein RhiirA1_475738 [Rhizophagus irregularis] Length = 553 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +IEKF ELP Y+T+E F+++QF+LK +VNV++K+ A+ AF+S KT Sbjct: 29 LIEKFSELPSYRTAENFNVTQFELKAYVNVDNKEEAHKWFAAFQSWSKT 77 >gb|PKC08928.1| hypothetical protein RhiirA5_416330, partial [Rhizophagus irregularis] Length = 675 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = -2 Query: 452 IIEKFYELPFYQTSEKFSISQFKLKTFVNVNDKKAAYGRIQAFESHLKT 306 +IEKF ELP Y+T+E F+++QF+LK +VNV++K+ A+ AF+S KT Sbjct: 18 LIEKFSELPSYRTAENFNVTQFELKAYVNVDNKEEAHKWFAAFQSWSKT 66