BLASTX nr result
ID: Ophiopogon27_contig00053614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053614 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX69698.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] >gi... 59 3e-07 gb|EXX69695.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] 59 4e-07 gb|EXX69694.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] 59 4e-07 gb|EXX69696.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] 59 4e-07 gb|PKY40124.1| SCA7-domain-containing protein [Rhizophagus irreg... 59 4e-07 gb|EXX69693.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] >gi... 59 4e-07 gb|POG76132.1| hypothetical protein GLOIN_2v1769366 [Rhizophagus... 59 4e-07 >gb|EXX69698.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] gb|EXX69701.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] gb|PKC10622.1| SCA7-domain-containing protein [Rhizophagus irregularis] gb|PKC72860.1| SCA7-domain-containing protein [Rhizophagus irregularis] Length = 262 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 231 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 262 >gb|EXX69695.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] Length = 321 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 290 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 321 >gb|EXX69694.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] Length = 322 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 291 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 322 >gb|EXX69696.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] Length = 329 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 298 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 329 >gb|PKY40124.1| SCA7-domain-containing protein [Rhizophagus irregularis] Length = 350 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 319 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 350 >gb|EXX69693.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] gb|EXX69697.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] gb|EXX69700.1| Sgf73p [Rhizophagus irregularis DAOM 197198w] gb|PKY15090.1| SCA7-domain-containing protein [Rhizophagus irregularis] Length = 350 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 319 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 350 >gb|POG76132.1| hypothetical protein GLOIN_2v1769366 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 360 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +3 Query: 3 QPLVTRSTPYVPQRSSYFIYNDMNDMLPKGIA 98 +PLVTRST YVPQRS+YFIYND+N++LPKG+A Sbjct: 329 RPLVTRSTSYVPQRSNYFIYNDINEILPKGVA 360