BLASTX nr result
ID: Ophiopogon27_contig00053400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053400 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52229.1| Hfi1p [Rhizophagus irregularis DAOM 197198w] >gi|... 147 6e-40 >gb|EXX52229.1| Hfi1p [Rhizophagus irregularis DAOM 197198w] gb|EXX52230.1| Hfi1p [Rhizophagus irregularis DAOM 197198w] gb|EXX52231.1| Hfi1p [Rhizophagus irregularis DAOM 197198w] gb|PKC02651.1| hypothetical protein RhiirA5_380807 [Rhizophagus irregularis] gb|PKC74504.1| hypothetical protein RhiirA1_449916 [Rhizophagus irregularis] gb|PKK70044.1| hypothetical protein RhiirC2_780219 [Rhizophagus irregularis] gb|PKY25864.1| hypothetical protein RhiirB3_512027 [Rhizophagus irregularis] gb|PKY49525.1| hypothetical protein RhiirA4_423028 [Rhizophagus irregularis] gb|POG57851.1| hypothetical protein GLOIN_2v1736089 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 367 Score = 147 bits (371), Expect = 6e-40 Identities = 71/71 (100%), Positives = 71/71 (100%) Frame = +1 Query: 262 MQIPKGMSGTTQAGPSNSQKGKAKMSASSPKPTPTNNRRNGDSQTPLPNVDERFERVTYL 441 MQIPKGMSGTTQAGPSNSQKGKAKMSASSPKPTPTNNRRNGDSQTPLPNVDERFERVTYL Sbjct: 1 MQIPKGMSGTTQAGPSNSQKGKAKMSASSPKPTPTNNRRNGDSQTPLPNVDERFERVTYL 60 Query: 442 SNGRIDTYQIK 474 SNGRIDTYQIK Sbjct: 61 SNGRIDTYQIK 71