BLASTX nr result
ID: Ophiopogon27_contig00053290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053290 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC20262.1| hypothetical protein RIR_0767600 [Rhizophagus ir... 55 5e-06 dbj|GBC25654.1| hypothetical protein RIR_1206700 [Rhizophagus ir... 55 5e-06 >dbj|GBC20262.1| hypothetical protein RIR_0767600 [Rhizophagus irregularis DAOM 181602] Length = 365 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +1 Query: 349 IYAFDWLDTLQEKWAKELIADFVTPFRTQGIVTPF 453 +YA+ WLDTL+E WA++LIADFV PFR G V PF Sbjct: 15 LYAYYWLDTLKEPWARKLIADFVMPFRANGTVIPF 49 >dbj|GBC25654.1| hypothetical protein RIR_1206700 [Rhizophagus irregularis DAOM 181602] Length = 398 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +1 Query: 349 IYAFDWLDTLQEKWAKELIADFVTPFRTQGIVTPF 453 +YA+ WLDTL+E WA++LIADFV PFR G V PF Sbjct: 15 LYAYYWLDTLKEPWARKLIADFVMPFRANGTVIPF 49