BLASTX nr result
ID: Ophiopogon27_contig00053231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053231 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52671.1| hypothetical protein RirG_251040 [Rhizophagus irr... 58 3e-07 gb|EXX52672.1| hypothetical protein RirG_251040 [Rhizophagus irr... 57 6e-07 >gb|EXX52671.1| hypothetical protein RirG_251040 [Rhizophagus irregularis DAOM 197198w] gb|PKC06991.1| hypothetical protein RhiirA5_418836 [Rhizophagus irregularis] Length = 301 Score = 58.2 bits (139), Expect = 3e-07 Identities = 36/80 (45%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = -3 Query: 287 MSSPATIPRAFINMSSSPIIDLTISPMSV-RTQAVEVVFISDTEDEXXXXXXXXXXXXXX 111 MSSPATIPR FINMS+S IDLT++P+ V RT +++ IS++EDE Sbjct: 1 MSSPATIPRTFINMSASSPIDLTMTPLPVRRTPVTDIIIISESEDE--NNDSSHRNNSNY 58 Query: 110 XXXXXXXXXXXLGFDNQNIF 51 LGFD+QNIF Sbjct: 59 RFNDNNNPNSMLGFDSQNIF 78 >gb|EXX52672.1| hypothetical protein RirG_251040 [Rhizophagus irregularis DAOM 197198w] dbj|GBC25301.1| sumo-targeted ubiquitin-protein ligase subunit rfp1 [Rhizophagus irregularis DAOM 181602] Length = 266 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/46 (60%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -3 Query: 287 MSSPATIPRAFINMSSSPIIDLTISPMSV-RTQAVEVVFISDTEDE 153 MSSPATIPR FINMS+S IDLT++P+ V RT +++ IS++EDE Sbjct: 1 MSSPATIPRTFINMSASSPIDLTMTPLPVRRTPVTDIIIISESEDE 46