BLASTX nr result
ID: Ophiopogon27_contig00053152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053152 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX68974.1| hypothetical protein RirG_100160 [Rhizophagus irr... 270 1e-85 gb|PKY40035.1| hypothetical protein RhiirA4_415528 [Rhizophagus ... 160 7e-44 gb|PKC10418.1| hypothetical protein RhiirA5_288788 [Rhizophagus ... 157 9e-43 ref|XP_011088833.1| pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_011043483.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_011043482.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 ref|XP_008378113.2| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 56 3e-06 gb|OAY76302.1| Pentatricopeptide repeat-containing protein [Anan... 56 4e-06 ref|XP_007317750.1| hypothetical protein SERLADRAFT_361210 [Serp... 56 4e-06 ref|XP_020111835.1| pentatricopeptide repeat-containing protein ... 56 4e-06 ref|XP_019263319.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_016449169.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_009785709.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 emb|CDP20360.1| unnamed protein product [Coffea canephora] 55 5e-06 ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_024161667.1| pentatricopeptide repeat-containing protein ... 55 5e-06 ref|XP_019263317.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_016449168.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_009785708.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 >gb|EXX68974.1| hypothetical protein RirG_100160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC23824.1| pentatricopeptide repeat protein [Rhizophagus irregularis DAOM 181602] Length = 575 Score = 270 bits (691), Expect = 1e-85 Identities = 135/142 (95%), Positives = 136/142 (95%) Frame = -1 Query: 426 MRGSPVRLFTATSKLKTTEIVSSNDIDTSNINLLRTDSNKIEDTRAEGTREERIFIGNFR 247 MRGSPVRLFTATSKLKTTEIVSSNDIDTSNINLLR DSNKIEDTRAE TREERIFIGNFR Sbjct: 1 MRGSPVRLFTATSKLKTTEIVSSNDIDTSNINLLRKDSNKIEDTRAEDTREERIFIGNFR 60 Query: 246 EEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMKLA 67 EEMDKFSERK W IL+LCEEVKQSDRKPDISIYNTIL AYIPLGSIKHSFKILEDMKLA Sbjct: 61 EEMDKFSERKHWRAILKLCEEVKQSDRKPDISIYNTILRAYIPLGSIKHSFKILEDMKLA 120 Query: 66 NVNPNLTTYHYLLRTWSQAPTS 1 NVNPNLTTYHYLLRTWSQAPTS Sbjct: 121 NVNPNLTTYHYLLRTWSQAPTS 142 >gb|PKY40035.1| hypothetical protein RhiirA4_415528 [Rhizophagus irregularis] Length = 520 Score = 160 bits (405), Expect = 7e-44 Identities = 76/80 (95%), Positives = 77/80 (96%) Frame = -1 Query: 240 MDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMKLANV 61 MDKFSERK W IL+LCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMKLANV Sbjct: 1 MDKFSERKHWRAILKLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMKLANV 60 Query: 60 NPNLTTYHYLLRTWSQAPTS 1 NPNLTTYHYLLRTWSQAPTS Sbjct: 61 NPNLTTYHYLLRTWSQAPTS 80 >gb|PKC10418.1| hypothetical protein RhiirA5_288788 [Rhizophagus irregularis] gb|PKC71524.1| hypothetical protein RhiirA1_390491 [Rhizophagus irregularis] gb|PKK70843.1| hypothetical protein RhiirC2_711597 [Rhizophagus irregularis] gb|PKY13848.1| hypothetical protein RhiirB3_324047 [Rhizophagus irregularis] gb|POG70846.1| hypothetical protein GLOIN_2v1612475 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 513 Score = 157 bits (397), Expect = 9e-43 Identities = 75/80 (93%), Positives = 76/80 (95%) Frame = -1 Query: 240 MDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMKLANV 61 MDKFSERK W IL+LCEEVKQSDRKPDISIYNTIL AYIPLGSIKHSFKILEDMKLANV Sbjct: 1 MDKFSERKHWRAILKLCEEVKQSDRKPDISIYNTILRAYIPLGSIKHSFKILEDMKLANV 60 Query: 60 NPNLTTYHYLLRTWSQAPTS 1 NPNLTTYHYLLRTWSQAPTS Sbjct: 61 NPNLTTYHYLLRTWSQAPTS 80 >ref|XP_011088833.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] ref|XP_020549790.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] Length = 625 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + G + +F F ++ FSE E +++ ++K+ KP IS +NT++ Sbjct: 120 ISQVQNNGMEPDSVF---FNAVVNAFSESGDMEEAMKMFSKMKEHGMKPTISTFNTLIKG 176 Query: 126 YIPLGSIKHSFKILED-MKLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M+ N+ PNL TY+ L+R W Sbjct: 177 YGIAGKPEESVKIMEQMMREENIKPNLRTYNVLVRAW 213 >ref|XP_011043483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Populus euphratica] ref|XP_011043484.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Populus euphratica] ref|XP_011043485.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Populus euphratica] ref|XP_011043486.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Populus euphratica] Length = 555 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/78 (34%), Positives = 43/78 (55%) Frame = -1 Query: 252 FREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMK 73 F ++ FSE E ++L ++K+S KP S YNT++ Y G + + K+LE ++ Sbjct: 67 FNSIINAFSESGNMKEAMKLFRKMKESGCKPTTSTYNTLIKGYGNAGKTEEALKLLEFLQ 126 Query: 72 LANVNPNLTTYHYLLRTW 19 V PN TY+ L+R W Sbjct: 127 DGGVKPNQRTYNILVRAW 144 >ref|XP_011043482.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Populus euphratica] Length = 616 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/78 (34%), Positives = 43/78 (55%) Frame = -1 Query: 252 FREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSIKHSFKILEDMK 73 F ++ FSE E ++L ++K+S KP S YNT++ Y G + + K+LE ++ Sbjct: 128 FNSIINAFSESGNMKEAMKLFRKMKESGCKPTTSTYNTLIKGYGNAGKTEEALKLLEFLQ 187 Query: 72 LANVNPNLTTYHYLLRTW 19 V PN TY+ L+R W Sbjct: 188 DGGVKPNQRTYNILVRAW 205 >ref|XP_008378113.2| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g25630-like [Malus domestica] Length = 627 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I G + IF F ++ FSE E +++ ++K+S KP S YNT++ Sbjct: 121 ISQVEENGLSPDLIF---FNAVINAFSESGNVEEAMKMFRKMKESGLKPTTSTYNTLIKG 177 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S K+LE M + NV PN+ TY+ L+R W Sbjct: 178 YGISGKPEDSLKVLEMMSREENVKPNIRTYNVLVRAW 214 >gb|OAY76302.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 456 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/90 (30%), Positives = 53/90 (58%) Frame = -1 Query: 285 GTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSI 106 G+R R ++ +F + M FS E+LRL E+K S+ P++ YNT+++A + Sbjct: 91 GSRPSRPYLSDFNKLMKAFSRGGAIEEVLRLFNELKGSECSPNVLCYNTVINALVIADRP 150 Query: 105 KHSFKILEDMKLANVNPNLTTYHYLLRTWS 16 + + + ++M L+ V PN+++Y+ L++ S Sbjct: 151 REAQAMFDEMLLSGVAPNVSSYNILVKLHS 180 >ref|XP_007317750.1| hypothetical protein SERLADRAFT_361210 [Serpula lacrymans var. lacrymans S7.9] gb|EGO25628.1| hypothetical protein SERLADRAFT_361210 [Serpula lacrymans var. lacrymans S7.9] Length = 567 Score = 55.8 bits (133), Expect = 4e-06 Identities = 31/99 (31%), Positives = 53/99 (53%) Frame = -1 Query: 300 DTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYI 121 DT +GT + R I + EM + E R+ + LRLC+ +K + +P + IYN++L A Sbjct: 69 DTNYQGT-QRRSAIARCQSEMARLGEMGRFADCLRLCKSMKNQNIQPTLLIYNSMLAAGS 127 Query: 120 PLGSIKHSFKILEDMKLANVNPNLTTYHYLLRTWSQAPT 4 G I ++ I EDM + P+ ++H+L+ P+ Sbjct: 128 RDGFITEAWGIFEDMISMGIQPDRQSFHHLIHASRHQPS 166 >ref|XP_020111835.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Ananas comosus] ref|XP_020111836.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Ananas comosus] ref|XP_020111837.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Ananas comosus] ref|XP_020111838.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Ananas comosus] ref|XP_020111839.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Ananas comosus] ref|XP_020111840.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Ananas comosus] ref|XP_020111841.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Ananas comosus] ref|XP_020111842.1| pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Ananas comosus] Length = 585 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/90 (30%), Positives = 53/90 (58%) Frame = -1 Query: 285 GTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHAYIPLGSI 106 G+R R ++ +F + M FS E+LRL E+K S+ P++ YNT+++A + Sbjct: 91 GSRPSRPYLSDFNKLMKAFSRGGAIEEVLRLFNELKGSECSPNVLCYNTVINALVIADRP 150 Query: 105 KHSFKILEDMKLANVNPNLTTYHYLLRTWS 16 + + + ++M L+ V PN+++Y+ L++ S Sbjct: 151 REAQAMFDEMLLSGVAPNVSSYNILVKLHS 180 >ref|XP_019263319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Nicotiana attenuata] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 124 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 181 YGIAGKPEESIKIMELMSQEVNVKPNLRTYNVLVKAW 217 >ref|XP_016449169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449171.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] ref|XP_016449172.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Nicotiana tabacum] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 124 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 181 YGIAGKPEESIKIMELMLQEVNVEPNLRTYNVLVKAW 217 >ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Solanum pennellii] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 + + + G + + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 124 MSEVQESGMKPDPVF---FNAVVNAFSESGNMEEAMKTFLQMKESGIKPAISTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 181 YGIAGKPEESIKIMELMSREVNVKPNLRTYNVLVKAW 217 >ref|XP_009785709.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Nicotiana sylvestris] ref|XP_009785711.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Nicotiana sylvestris] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 124 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 181 YGIAGKPEESIKIMELMSQEVNVEPNLRTYNVLVKAW 217 >emb|CDP20360.1| unnamed protein product [Coffea canephora] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I G + + IF + ++ F+E E + ++K+S KP S +NT++ Sbjct: 124 ISHVEENGMKPDSIF---YNAVVNAFAESGNMEEAMETLLKMKESGMKPTTSTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y +G + S K+LE M K N+ PNL TY+ L+R W Sbjct: 181 YGLIGKPEESLKVLELMSKEENIKPNLRTYNVLIRAW 217 >ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] ref|XP_006356648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] Length = 629 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 + + + G + + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 124 MSEVQESGMKPDPVF---FNAVVNAFSESGNMEEAMKTFLQMKESGIKPAISTFNTLIKG 180 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 181 YGIAGKPEESIKIMELMSREVNVKPNLRTYNVLVKAW 217 >ref|XP_024161667.1| pentatricopeptide repeat-containing protein At5g25630 [Rosa chinensis] gb|PRQ27478.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 636 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I G + + IF F ++ FSE + E + +++K+S KP S YNT++ Sbjct: 131 ISQVEENGMKPDSIF---FNAVINAFSEAGKMEEAMDTVQKMKESGLKPTTSTYNTLIKG 187 Query: 126 YIPLGSIKHSFKILEDMK-LANVNPNLTTYHYLLRTW 19 Y G + S K+LE M NV PN+ T++ L+R W Sbjct: 188 YGISGKPEESLKLLEMMSGEENVRPNIRTFNVLVRAW 224 >ref|XP_019263317.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana attenuata] gb|OIT37243.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 640 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 135 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 191 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 192 YGIAGKPEESIKIMELMSQEVNVKPNLRTYNVLVKAW 228 >ref|XP_016449168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Nicotiana tabacum] Length = 643 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 138 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 194 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 195 YGIAGKPEESIKIMELMLQEVNVEPNLRTYNVLVKAW 231 >ref|XP_009785708.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana sylvestris] Length = 643 Score = 55.5 bits (132), Expect = 5e-06 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 1/97 (1%) Frame = -1 Query: 306 IEDTRAEGTREERIFIGNFREEMDKFSERKRWNEILRLCEEVKQSDRKPDISIYNTILHA 127 I + + G + +F F ++ FSE E ++ ++K+S KP IS +NT++ Sbjct: 138 ISEVQENGMNPDPVF---FNAVVNAFSESGNMEEAMKAFLQMKESGIKPAISTFNTLIKG 194 Query: 126 YIPLGSIKHSFKILEDM-KLANVNPNLTTYHYLLRTW 19 Y G + S KI+E M + NV PNL TY+ L++ W Sbjct: 195 YGIAGKPEESIKIMELMSQEVNVEPNLRTYNVLVKAW 231