BLASTX nr result
ID: Ophiopogon27_contig00053009
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00053009 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC08727.1| HD phosphohydrolase domain-containing protein [Rh... 91 1e-18 dbj|GBC35627.1| similarity to hypothetical protein y461_mycpn [R... 91 1e-18 gb|PKY44288.1| HD phosphohydrolase domain-containing protein, pa... 90 3e-18 >gb|PKC08727.1| HD phosphohydrolase domain-containing protein [Rhizophagus irregularis] gb|PKC63871.1| HD phosphohydrolase domain-containing protein [Rhizophagus irregularis] gb|PKY23614.1| HD phosphohydrolase domain-containing protein [Rhizophagus irregularis] Length = 465 Score = 90.5 bits (223), Expect = 1e-18 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 391 EETSIRVFARDPEKMKPIQECFRKLLKSYISNPPNPPHNAIPSGELTPSRGYTLPEDFET 212 EE SIR+FAR PEKMKPIQECFRKLLK + PHN IP+ E+TPSRGYTLPE +ET Sbjct: 386 EEISIRIFARKPEKMKPIQECFRKLLKIH------APHNTIPNEEITPSRGYTLPEGYET 439 Query: 211 PRKR 200 +KR Sbjct: 440 SKKR 443 >dbj|GBC35627.1| similarity to hypothetical protein y461_mycpn [Rhizophagus irregularis DAOM 181602] gb|PKK74837.1| HD phosphohydrolase domain-containing protein [Rhizophagus irregularis] gb|POG63205.1| hypothetical protein GLOIN_2v1688620 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 500 Score = 90.5 bits (223), Expect = 1e-18 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 391 EETSIRVFARDPEKMKPIQECFRKLLKSYISNPPNPPHNAIPSGELTPSRGYTLPEDFET 212 EE SIR+FAR PEKMKPIQECFRKLLK + PHN IP+ E+TPSRGYTLPE +ET Sbjct: 421 EEISIRIFARKPEKMKPIQECFRKLLKIH------APHNTIPNEEITPSRGYTLPEGYET 474 Query: 211 PRKR 200 +KR Sbjct: 475 SKKR 478 >gb|PKY44288.1| HD phosphohydrolase domain-containing protein, partial [Rhizophagus irregularis] Length = 500 Score = 89.7 bits (221), Expect = 3e-18 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 391 EETSIRVFARDPEKMKPIQECFRKLLKSYISNPPNPPHNAIPSGELTPSRGYTLPEDFET 212 EE SIR+FAR PEKMKPIQECFRKLLK + PHN IP+ E+TPSRGYTLPE +ET Sbjct: 421 EEISIRIFARKPEKMKPIQECFRKLLKIH------APHNTIPNEEITPSRGYTLPEVYET 474 Query: 211 PRKR 200 +KR Sbjct: 475 SKKR 478