BLASTX nr result
ID: Ophiopogon27_contig00052825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052825 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC29154.1| retrotransposable element [Rhizophagus irregular... 56 1e-07 dbj|GBC27215.1| retrotransposable element [Rhizophagus irregular... 56 1e-07 dbj|GBC41221.1| retrotransposable element [Rhizophagus irregular... 56 1e-07 >dbj|GBC29154.1| retrotransposable element [Rhizophagus irregularis DAOM 181602] Length = 743 Score = 55.8 bits (133), Expect(2) = 1e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -2 Query: 341 KLAFITQYDTYQFLGMLFGLCNAMATFQRLMN 246 K AFITQY TYQFL M FGLCNA ATFQRLMN Sbjct: 502 KTAFITQYGTYQFLVMPFGLCNAPATFQRLMN 533 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 393 HTSYGSTKVIASGYWQVEV 337 H S+ ++ +ASGYWQVEV Sbjct: 477 HVSWYTSLDLASGYWQVEV 495 >dbj|GBC27215.1| retrotransposable element [Rhizophagus irregularis DAOM 181602] Length = 368 Score = 55.8 bits (133), Expect(2) = 1e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -2 Query: 341 KLAFITQYDTYQFLGMLFGLCNAMATFQRLMN 246 K AFITQY TYQFL M FGLCNA ATFQRLMN Sbjct: 58 KTAFITQYGTYQFLVMPFGLCNAPATFQRLMN 89 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 393 HTSYGSTKVIASGYWQVEV 337 H S+ ++ +ASGYWQVEV Sbjct: 33 HVSWYTSLDLASGYWQVEV 51 >dbj|GBC41221.1| retrotransposable element [Rhizophagus irregularis DAOM 181602] Length = 265 Score = 55.8 bits (133), Expect(2) = 1e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -2 Query: 341 KLAFITQYDTYQFLGMLFGLCNAMATFQRLMN 246 K AFITQY TYQFL M FGLCNA ATFQRLMN Sbjct: 32 KTAFITQYGTYQFLVMPFGLCNAPATFQRLMN 63 Score = 27.7 bits (60), Expect(2) = 1e-07 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 393 HTSYGSTKVIASGYWQVEV 337 H S+ ++ +ASGYWQVEV Sbjct: 7 HVSWYTSLDLASGYWQVEV 25