BLASTX nr result
ID: Ophiopogon27_contig00052707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052707 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY41221.1| hypothetical protein RhiirA4_454760 [Rhizophagus ... 64 4e-10 gb|PKY48732.1| hypothetical protein RhiirA4_464402 [Rhizophagus ... 64 1e-09 gb|PKC50873.1| hypothetical protein RhiirA1_543800 [Rhizophagus ... 57 9e-08 gb|POG75215.1| hypothetical protein GLOIN_2v1475573 [Rhizophagus... 57 2e-07 gb|PKK75883.1| hypothetical protein RhiirC2_845631 [Rhizophagus ... 55 5e-07 >gb|PKY41221.1| hypothetical protein RhiirA4_454760 [Rhizophagus irregularis] Length = 128 Score = 63.5 bits (153), Expect = 4e-10 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = +2 Query: 59 RKLNNGTAKGGSMHDEQNMDNNEDIKAG-TKITNKD 163 RKLNNGTAKGGSMHD+QNM+NNEDIKA TKITNK+ Sbjct: 68 RKLNNGTAKGGSMHDKQNMNNNEDIKAELTKITNKE 103 >gb|PKY48732.1| hypothetical protein RhiirA4_464402 [Rhizophagus irregularis] Length = 179 Score = 63.5 bits (153), Expect = 1e-09 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 59 RKLNNGTAKGGSMHDEQNMDNNEDIKAG-TKITNKDRIFIYHHSFRTYRS 205 RKLNNGT+KGGSMHD+Q MDNNEDIKA TKITNK+ + H FR S Sbjct: 91 RKLNNGTSKGGSMHDKQKMDNNEDIKAELTKITNKE---MRHRRFRVILS 137 >gb|PKC50873.1| hypothetical protein RhiirA1_543800 [Rhizophagus irregularis] Length = 92 Score = 56.6 bits (135), Expect = 9e-08 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +2 Query: 68 NNGTAKGGSMHDEQNMDNNEDIKAG-TKITNKD 163 NNGT+KGGSMHD+Q MDNNEDIKA TKITNK+ Sbjct: 41 NNGTSKGGSMHDKQKMDNNEDIKAELTKITNKE 73 >gb|POG75215.1| hypothetical protein GLOIN_2v1475573 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 131 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +2 Query: 68 NNGTAKGGSMHDEQNMDNNEDIKAG-TKITNKD 163 NNGT+KGGSMHD+Q MDNNEDIKA TKITNK+ Sbjct: 81 NNGTSKGGSMHDKQKMDNNEDIKAELTKITNKE 113 >gb|PKK75883.1| hypothetical protein RhiirC2_845631 [Rhizophagus irregularis] Length = 92 Score = 54.7 bits (130), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +2 Query: 68 NNGTAKGGSMHDEQNMDNNEDIKAG-TKITNKD 163 NNGT+KGGSMHD+Q M+NNEDIKA TKITNK+ Sbjct: 41 NNGTSKGGSMHDKQKMNNNEDIKAELTKITNKE 73