BLASTX nr result
ID: Ophiopogon27_contig00052612
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052612 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY39807.1| hypothetical protein RhiirA4_440302 [Rhizophagus ... 70 5e-11 dbj|GBC52092.1| hypothetical protein RIR_3350600 [Rhizophagus ir... 68 2e-10 >gb|PKY39807.1| hypothetical protein RhiirA4_440302 [Rhizophagus irregularis] Length = 402 Score = 69.7 bits (169), Expect = 5e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +2 Query: 203 GSHFSIRFWSFVATRQNPILAVIFVDGMSNYILHLLDSNS 322 G FSIR WS VATRQNPILAV+F+DGMS++ILHLLDSNS Sbjct: 60 GLQFSIRIWSCVATRQNPILAVVFIDGMSDFILHLLDSNS 99 >dbj|GBC52092.1| hypothetical protein RIR_3350600 [Rhizophagus irregularis DAOM 181602] gb|PKC73178.1| hypothetical protein RhiirA1_437739 [Rhizophagus irregularis] gb|PKK78805.1| hypothetical protein RhiirC2_861016 [Rhizophagus irregularis] gb|POG65919.1| hypothetical protein GLOIN_2v1662066 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 402 Score = 68.2 bits (165), Expect = 2e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +2 Query: 203 GSHFSIRFWSFVATRQNPILAVIFVDGMSNYILHLLDSNS 322 G FSIR WS VATR+NPILAV+F+DGMS++ILHLLDSNS Sbjct: 60 GLQFSIRIWSCVATRKNPILAVVFIDGMSDFILHLLDSNS 99