BLASTX nr result
ID: Ophiopogon27_contig00052410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052410 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC53250.1| Tis13_346008 [Rhizophagus irregularis DAOM 181602] 68 3e-12 >dbj|GBC53250.1| Tis13_346008 [Rhizophagus irregularis DAOM 181602] Length = 78 Score = 67.8 bits (164), Expect = 3e-12 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 212 RAFVNMITALPIQNFSDNQMIHEFFNGFSFYNTY*SF 102 RA +NMIT LPIQNFSDNQMIHEFFNG FYNTY SF Sbjct: 41 RAHLNMITTLPIQNFSDNQMIHEFFNGIPFYNTYQSF 77