BLASTX nr result
ID: Ophiopogon27_contig00052351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052351 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX52982.1| hypothetical protein RirG_248180 [Rhizophagus irr... 164 1e-49 gb|PKY42293.1| hypothetical protein RhiirA4_441883 [Rhizophagus ... 159 8e-48 >gb|EXX52982.1| hypothetical protein RirG_248180 [Rhizophagus irregularis DAOM 197198w] gb|PKC09197.1| hypothetical protein RhiirA5_499443 [Rhizophagus irregularis] gb|PKC70779.1| hypothetical protein RhiirA1_532450 [Rhizophagus irregularis] gb|PKK78876.1| hypothetical protein RhiirC2_769745 [Rhizophagus irregularis] gb|PKY24226.1| hypothetical protein RhiirB3_527057 [Rhizophagus irregularis] gb|POG75581.1| hypothetical protein GLOIN_2v1770002 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 143 Score = 164 bits (415), Expect = 1e-49 Identities = 82/85 (96%), Positives = 84/85 (98%) Frame = -3 Query: 392 PMPKILSPTFLGNLNKVDDASSEVISNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR 213 P+PKILSPTFLGNLNKVDDASSEV+SNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR Sbjct: 59 PIPKILSPTFLGNLNKVDDASSEVVSNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR 118 Query: 212 KELSGTIDTLNNSNIPIGEGDDSKS 138 KEL GTIDTLNNSNIPIGEGDDSKS Sbjct: 119 KELRGTIDTLNNSNIPIGEGDDSKS 143 >gb|PKY42293.1| hypothetical protein RhiirA4_441883 [Rhizophagus irregularis] Length = 146 Score = 159 bits (403), Expect = 8e-48 Identities = 79/83 (95%), Positives = 82/83 (98%) Frame = -3 Query: 392 PMPKILSPTFLGNLNKVDDASSEVISNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR 213 P+PKILSPTFLGNLNKVDDASSEV+SNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR Sbjct: 59 PIPKILSPTFLGNLNKVDDASSEVVSNTYEIITNFIRVNEQLIKSQKDLDGLGSDIEVLR 118 Query: 212 KELSGTIDTLNNSNIPIGEGDDS 144 KEL GTIDTLNNSNIPIGEGDD+ Sbjct: 119 KELRGTIDTLNNSNIPIGEGDDN 141