BLASTX nr result
ID: Ophiopogon27_contig00052171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052171 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK58548.1| hypothetical protein RhiirC2_796134 [Rhizophagus ... 50 9e-14 >gb|PKK58548.1| hypothetical protein RhiirC2_796134 [Rhizophagus irregularis] Length = 102 Score = 50.1 bits (118), Expect(3) = 9e-14 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 214 GKKVDSLKPIAKKRLEPLFDHIPSTQIDFV 303 GKKVDSLKPI KKRL PLFD IPST+I+ + Sbjct: 33 GKKVDSLKPIVKKRLAPLFDRIPSTKINLL 62 Score = 41.6 bits (96), Expect(3) = 9e-14 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +3 Query: 306 NHPRDERSMQPTTSISDYFQQAPNPNDINIFVYP 407 NHP DE+ MQ TT IS+YF + + N I+IFV P Sbjct: 64 NHPNDEKRMQATTPISNYFTENLDENMIHIFVSP 97 Score = 32.3 bits (72), Expect(3) = 9e-14 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 173 HQNDNEIFVIEISREKRLIHSSP 241 +QNDNEIFVIEISR K++ P Sbjct: 19 NQNDNEIFVIEISRGKKVDSLKP 41