BLASTX nr result
ID: Ophiopogon27_contig00052105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00052105 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK65555.1| hypothetical protein RhiirC2_715469 [Rhizophagus ... 55 8e-06 >gb|PKK65555.1| hypothetical protein RhiirC2_715469 [Rhizophagus irregularis] Length = 337 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +1 Query: 169 YLVRQKGCWNTNVPGFTCKSSVFNTRVR*EVA--GKNLHL 282 +LVRQKGCW++N P FTCKSSVFN RVR E + K +HL Sbjct: 189 FLVRQKGCWDSNAPEFTCKSSVFNIRVRMEKSEVDKQVHL 228