BLASTX nr result
ID: Ophiopogon27_contig00051749
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051749 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK68324.1| hypothetical protein RhiirC2_750368 [Rhizophagus ... 122 1e-29 gb|PKY50652.1| hypothetical protein RhiirA4_406713 [Rhizophagus ... 121 2e-29 gb|PKC02350.1| hypothetical protein RhiirA5_364201 [Rhizophagus ... 121 2e-29 gb|EXX62500.1| Mdm1p [Rhizophagus irregularis DAOM 197198w] 121 2e-29 >gb|PKK68324.1| hypothetical protein RhiirC2_750368 [Rhizophagus irregularis] Length = 446 Score = 122 bits (305), Expect = 1e-29 Identities = 63/116 (54%), Positives = 81/116 (69%), Gaps = 7/116 (6%) Frame = -2 Query: 327 SRIILLDPLSKVASPYFKTPNNDDTGYT---KYLTAAMIYYFLASNFLLLPMYFLQIVIG 157 +R+IL DPL+K+A PYFKT N+ GYT KY+TA YY L +NFLLLP+YFLQI IG Sbjct: 21 TRMILFDPLAKIAFPYFKTVENEVNGYTTYLKYITAVTFYYLLVNNFLLLPLYFLQIFIG 80 Query: 156 AILICAILCQMTPLWEILTTSFKFTEFPTY----RTLNVKEIDNDIVGDLIPSEQQ 1 IL+ ILC TPLWEI TSFKFT+F + RT V+ +N ++G+LI + +Q Sbjct: 81 FILVFTILCNFTPLWEIFMTSFKFTDFYSIFTMERTSIVENFNNVMMGELIINSKQ 136 >gb|PKY50652.1| hypothetical protein RhiirA4_406713 [Rhizophagus irregularis] Length = 448 Score = 121 bits (304), Expect = 2e-29 Identities = 62/116 (53%), Positives = 81/116 (69%), Gaps = 7/116 (6%) Frame = -2 Query: 327 SRIILLDPLSKVASPYFKTPNNDDTGYT---KYLTAAMIYYFLASNFLLLPMYFLQIVIG 157 +R+IL DPL+K+A PYFKT N+ GYT KY+TA YY L +NFLLLP+YFLQI IG Sbjct: 21 TRMILFDPLAKIAFPYFKTVENEVNGYTTYLKYITAVTFYYLLVNNFLLLPLYFLQIFIG 80 Query: 156 AILICAILCQMTPLWEILTTSFKFTEFPTYRTLN----VKEIDNDIVGDLIPSEQQ 1 IL+ ILC TPLWEI TSFKFT+F + T+ V+ +N ++G+LI + +Q Sbjct: 81 FILVFTILCNFTPLWEIFMTSFKFTDFYSIFTMEKTSIVENFNNVMMGELIINSKQ 136 >gb|PKC02350.1| hypothetical protein RhiirA5_364201 [Rhizophagus irregularis] gb|PKC63344.1| hypothetical protein RhiirA1_422795 [Rhizophagus irregularis] gb|PKY26950.1| hypothetical protein RhiirB3_415663 [Rhizophagus irregularis] Length = 448 Score = 121 bits (304), Expect = 2e-29 Identities = 62/116 (53%), Positives = 81/116 (69%), Gaps = 7/116 (6%) Frame = -2 Query: 327 SRIILLDPLSKVASPYFKTPNNDDTGYT---KYLTAAMIYYFLASNFLLLPMYFLQIVIG 157 +R+IL DPL+K+A PYFKT N+ GYT KY+TA YY L +NFLLLP+YFLQI IG Sbjct: 21 TRMILFDPLAKIAFPYFKTVENEVNGYTTYLKYITAVTFYYLLVNNFLLLPLYFLQIFIG 80 Query: 156 AILICAILCQMTPLWEILTTSFKFTEFPTYRTLN----VKEIDNDIVGDLIPSEQQ 1 IL+ ILC TPLWEI TSFKFT+F + T+ V+ +N ++G+LI + +Q Sbjct: 81 FILVFTILCNFTPLWEIFMTSFKFTDFYSIFTMEKTSIVENFNNVMMGELIINSKQ 136 >gb|EXX62500.1| Mdm1p [Rhizophagus irregularis DAOM 197198w] Length = 448 Score = 121 bits (304), Expect = 2e-29 Identities = 62/116 (53%), Positives = 81/116 (69%), Gaps = 7/116 (6%) Frame = -2 Query: 327 SRIILLDPLSKVASPYFKTPNNDDTGYT---KYLTAAMIYYFLASNFLLLPMYFLQIVIG 157 +R+IL DPL+K+A PYFKT N+ GYT KY+TA YY L +NFLLLP+YFLQI IG Sbjct: 21 TRMILFDPLAKIAFPYFKTVENEVNGYTTYLKYITAVTFYYLLVNNFLLLPLYFLQIFIG 80 Query: 156 AILICAILCQMTPLWEILTTSFKFTEFPTYRTLN----VKEIDNDIVGDLIPSEQQ 1 IL+ ILC TPLWEI TSFKFT+F + T+ V+ +N ++G+LI + +Q Sbjct: 81 FILVFTILCNFTPLWEIFMTSFKFTDFYSIFTMEKTSIVENFNNVMMGELIINSKQ 136