BLASTX nr result
ID: Ophiopogon27_contig00051628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051628 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX61252.1| hypothetical protein RirG_173020 [Rhizophagus irr... 146 2e-38 >gb|EXX61252.1| hypothetical protein RirG_173020 [Rhizophagus irregularis DAOM 197198w] dbj|GBC37760.1| hypothetical protein RIR_2182800 [Rhizophagus irregularis DAOM 181602] gb|PKC14714.1| hypothetical protein RhiirA5_349917 [Rhizophagus irregularis] gb|PKC74259.1| hypothetical protein RhiirA1_409521 [Rhizophagus irregularis] gb|PKK61528.1| hypothetical protein RhiirC2_760595 [Rhizophagus irregularis] gb|PKY15566.1| hypothetical protein RhiirB3_401781 [Rhizophagus irregularis] gb|PKY45300.1| hypothetical protein RhiirA4_401048 [Rhizophagus irregularis] gb|POG58969.1| hypothetical protein GLOIN_2v1726323 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 679 Score = 146 bits (368), Expect = 2e-38 Identities = 78/113 (69%), Positives = 88/113 (77%) Frame = -2 Query: 364 DSQTLRLIDVXXXXXXXXXXXXXXXLCIVKAVLDDVGLKGLLFSNKITFTHLISSTSSST 185 DSQTLRLI+V LCIVKAVLD+VGL+GLLFSNKITFTHL+SS S++T Sbjct: 126 DSQTLRLIEVLKEKSKESPLKLASLLCIVKAVLDEVGLRGLLFSNKITFTHLVSSNSANT 185 Query: 184 REYTVEFEDQLRNNHFFPASQFNNEFLPNGSNNMMNNVSEIQHVFKAPLTSDP 26 REYTVEFEDQ N FFP+S +NN++L NGSNNMMNNVSEI HVFK PLTS P Sbjct: 186 REYTVEFEDQ--RNQFFPSSHYNNDYLTNGSNNMMNNVSEI-HVFKPPLTSVP 235