BLASTX nr result
ID: Ophiopogon27_contig00051318
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051318 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY61244.1| hypothetical protein RhiirA4_485945 [Rhizophagus ... 77 6e-15 >gb|PKY61244.1| hypothetical protein RhiirA4_485945 [Rhizophagus irregularis] Length = 157 Score = 77.0 bits (188), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 329 MEIPPTKILEKRIAIRKLNKKRFIINTLRKKVTEIRNYSN 448 ME PPTKILEKRIAIRKL+KKRFIINTLRKKVTEIRNYSN Sbjct: 1 METPPTKILEKRIAIRKLSKKRFIINTLRKKVTEIRNYSN 40