BLASTX nr result
ID: Ophiopogon27_contig00051244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051244 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC45010.1| aaa family ATPase [Rhizophagus irregularis DAOM ... 64 6e-09 gb|PKC62601.1| P-loop containing nucleoside triphosphate hydrola... 64 6e-09 gb|PKY54897.1| P-loop containing nucleoside triphosphate hydrola... 64 6e-09 gb|PKB99805.1| P-loop containing nucleoside triphosphate hydrola... 64 6e-09 gb|EXX50434.1| Msp1p [Rhizophagus irregularis DAOM 197198w] 64 6e-09 gb|PKY29951.1| P-loop containing nucleoside triphosphate hydrola... 64 6e-09 >dbj|GBC45010.1| aaa family ATPase [Rhizophagus irregularis DAOM 181602] gb|PKK62648.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis] gb|POG73329.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 526 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 469 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 521 >gb|PKC62601.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis] Length = 547 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 490 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 542 >gb|PKY54897.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis] Length = 563 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 506 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 558 >gb|PKB99805.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis] Length = 563 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 506 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 558 >gb|EXX50434.1| Msp1p [Rhizophagus irregularis DAOM 197198w] Length = 563 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 506 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 558 >gb|PKY29951.1| P-loop containing nucleoside triphosphate hydrolase protein [Rhizophagus irregularis] Length = 568 Score = 64.3 bits (155), Expect = 6e-09 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = +3 Query: 3 RPLNGREIKTAVRLAKDVAANGN--SSITTDLLEKILDISKSSNDEISGNIAE 155 RPLNGREIKTA+RLAK +A N + ITT+ LE ILDISKS +EI+GNI E Sbjct: 511 RPLNGREIKTAIRLAKALAMKNNPDAMITTEQLETILDISKSFKEEITGNIPE 563