BLASTX nr result
ID: Ophiopogon27_contig00051191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051191 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX69901.1| hypothetical protein RirG_092250 [Rhizophagus irr... 68 1e-10 gb|PKY49497.1| hypothetical protein RhiirA4_445895 [Rhizophagus ... 57 6e-07 >gb|EXX69901.1| hypothetical protein RirG_092250 [Rhizophagus irregularis DAOM 197198w] dbj|GBC45943.1| RNA polymerase II-associated factor 1 [Rhizophagus irregularis DAOM 181602] gb|PKC16942.1| hypothetical protein RhiirA5_466331 [Rhizophagus irregularis] gb|PKC76041.1| hypothetical protein RhiirA1_406853 [Rhizophagus irregularis] gb|PKK79365.1| hypothetical protein RhiirC2_727400 [Rhizophagus irregularis] gb|PKY13404.1| hypothetical protein RhiirB3_398764 [Rhizophagus irregularis] gb|PKY37743.1| hypothetical protein RhiirA4_530850 [Rhizophagus irregularis] gb|POG64010.1| RNA polymerase II-associated [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 442 Score = 68.2 bits (165), Expect = 1e-10 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 420 GGSTYLNVKYVSNIEKKTPEKLDSDYNFDKEHDKDSDKNSDTSGKRLR 277 GGSTYLNV+YV NIEK+ PE+LDSD N D DKD DKNSD SGKR R Sbjct: 357 GGSTYLNVEYVQNIEKRMPERLDSDDNDD--FDKDIDKNSDISGKRKR 402 >gb|PKY49497.1| hypothetical protein RhiirA4_445895 [Rhizophagus irregularis] Length = 197 Score = 56.6 bits (135), Expect = 6e-07 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 420 GGSTYLNVKYVSNIEKKTPEKLDSDYNFDKEHDKDSDKNSDTSGKR 283 GGSTYLNV+YV NIEK+ E+LDSD N DKD +KNSD S KR Sbjct: 6 GGSTYLNVEYVQNIEKRMLERLDSDDN--DNFDKDINKNSDISRKR 49