BLASTX nr result
ID: Ophiopogon27_contig00051075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051075 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK80265.1| ARM repeat-containing protein [Rhizophagus irregu... 80 5e-14 gb|EXX63225.1| Apl5p [Rhizophagus irregularis DAOM 197198w] >gi|... 80 5e-14 gb|PKY44951.1| hypothetical protein RhiirA4_400498 [Rhizophagus ... 75 1e-12 gb|PKC17495.1| hypothetical protein RhiirA5_346303 [Rhizophagus ... 75 1e-12 >gb|PKK80265.1| ARM repeat-containing protein [Rhizophagus irregularis] Length = 1193 Score = 80.1 bits (196), Expect = 5e-14 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 155 IQNANELSGIKKTPVKMLLNLDDLYISYTLHLGTTTEITNEPPTLVVDFTL 3 IQN +E +GIK+T K LL+ DDLYISY LHLGTTTEITNEPPTL+ DFT+ Sbjct: 927 IQNMSESNGIKRTTAKTLLDTDDLYISYILHLGTTTEITNEPPTLIADFTI 977 >gb|EXX63225.1| Apl5p [Rhizophagus irregularis DAOM 197198w] gb|EXX71451.1| Apl5p [Rhizophagus irregularis DAOM 197198w] gb|EXX71454.1| Apl5p [Rhizophagus irregularis DAOM 197198w] gb|EXX73063.1| Apl5p [Rhizophagus irregularis DAOM 197198w] dbj|GBC26394.1| AP-3 complex subunit delta [Rhizophagus irregularis DAOM 181602] gb|POG64583.1| hypothetical protein GLOIN_2v1673472 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 1252 Score = 80.1 bits (196), Expect = 5e-14 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -2 Query: 155 IQNANELSGIKKTPVKMLLNLDDLYISYTLHLGTTTEITNEPPTLVVDFTL 3 IQN +E +GIK+T K LL+ DDLYISY LHLGTTTEITNEPPTL+ DFT+ Sbjct: 986 IQNMSESNGIKRTTAKTLLDTDDLYISYILHLGTTTEITNEPPTLIADFTI 1036 >gb|PKY44951.1| hypothetical protein RhiirA4_400498 [Rhizophagus irregularis] Length = 264 Score = 74.7 bits (182), Expect = 1e-12 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 143 NELSGIKKTPVKMLLNLDDLYISYTLHLGTTTEITNEPPTLVVDFTL 3 +E +GIK+T K LL+ DDLYISY LHLGTTTEITNEPPTL+ DFT+ Sbjct: 2 SESNGIKRTTAKTLLDTDDLYISYILHLGTTTEITNEPPTLIADFTI 48 >gb|PKC17495.1| hypothetical protein RhiirA5_346303 [Rhizophagus irregularis] gb|PKC66750.1| hypothetical protein RhiirA1_418938 [Rhizophagus irregularis] gb|PKY13495.1| hypothetical protein RhiirB3_398912 [Rhizophagus irregularis] Length = 264 Score = 74.7 bits (182), Expect = 1e-12 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 143 NELSGIKKTPVKMLLNLDDLYISYTLHLGTTTEITNEPPTLVVDFTL 3 +E +GIK+T K LL+ DDLYISY LHLGTTTEITNEPPTL+ DFT+ Sbjct: 2 SESNGIKRTTAKTLLDTDDLYISYILHLGTTTEITNEPPTLIADFTI 48