BLASTX nr result
ID: Ophiopogon27_contig00051054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051054 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX67104.1| hypothetical protein RirG_117480 [Rhizophagus irr... 98 2e-33 gb|PKK76994.1| hypothetical protein RhiirC2_732943 [Rhizophagus ... 72 9e-14 >gb|EXX67104.1| hypothetical protein RirG_117480 [Rhizophagus irregularis DAOM 197198w] dbj|GBC20228.1| hypothetical protein RIR_0764400 [Rhizophagus irregularis DAOM 181602] gb|PKC13571.1| hypothetical protein RhiirA5_351443 [Rhizophagus irregularis] gb|PKC70096.1| hypothetical protein RhiirA1_414689 [Rhizophagus irregularis] gb|PKY42013.1| hypothetical protein RhiirA4_396776 [Rhizophagus irregularis] Length = 134 Score = 98.2 bits (243), Expect(2) = 2e-33 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 1/59 (1%) Frame = +1 Query: 1 AIYGRTSNIIERR-NHVHLSQRQASYEPSKEDLDALEALKAQFHAVCDELYLSLQNSKK 174 AIYGRTSNIIE R HLSQRQASYEPSKEDLDALE+LK QFH VCDE+YLSLQN+KK Sbjct: 19 AIYGRTSNIIEHRATQAHLSQRQASYEPSKEDLDALESLKTQFHIVCDEIYLSLQNTKK 77 Score = 72.4 bits (176), Expect(2) = 2e-33 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = +2 Query: 170 KKVLVRDYHENCEDLIRENKQKEEVKAEKIKSQNEKIVLLGKALELDKFSVQAEPSEDVK 349 KKV +R+YHEN E+LI ENK +E AEK+K QNEKI LL KALEL+KFS Q + K Sbjct: 76 KKVFLREYHENFEELILENKHHDEAIAEKMKIQNEKIALLRKALELNKFSDQND-----K 130 Query: 350 MDES 361 MDES Sbjct: 131 MDES 134 >gb|PKK76994.1| hypothetical protein RhiirC2_732943 [Rhizophagus irregularis] gb|PKY14555.1| hypothetical protein RhiirB3_400494 [Rhizophagus irregularis] gb|POG60980.1| hypothetical protein GLOIN_2v1708319 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 67 Score = 72.4 bits (176), Expect = 9e-14 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = +2 Query: 170 KKVLVRDYHENCEDLIRENKQKEEVKAEKIKSQNEKIVLLGKALELDKFSVQAEPSEDVK 349 KKV +R+YHEN E+LI ENK +E AEK+K QNEKI LL KALEL+KFS Q + K Sbjct: 9 KKVFLREYHENFEELILENKHHDEAIAEKMKIQNEKIALLRKALELNKFSDQND-----K 63 Query: 350 MDES 361 MDES Sbjct: 64 MDES 67