BLASTX nr result
ID: Ophiopogon27_contig00051044
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051044 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246871.1| receptor-like kinase TMK4 [Asparagus officin... 84 1e-15 >ref|XP_020246871.1| receptor-like kinase TMK4 [Asparagus officinalis] gb|ONK58121.1| uncharacterized protein A4U43_C09F8340 [Asparagus officinalis] Length = 911 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -3 Query: 468 VDQWVPSGSNYEEDSSMSLTQELEKWQSDSDSSLFSTFKGGSSTNHY 328 VDQWVPS YEEDSSMSL ELEKWQSDSDSSLF+T+KG SST+HY Sbjct: 865 VDQWVPSSFQYEEDSSMSLASELEKWQSDSDSSLFATYKGSSSTSHY 911