BLASTX nr result
ID: Ophiopogon27_contig00051043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051043 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246871.1| receptor-like kinase TMK4 [Asparagus officin... 57 3e-06 >ref|XP_020246871.1| receptor-like kinase TMK4 [Asparagus officinalis] gb|ONK58121.1| uncharacterized protein A4U43_C09F8340 [Asparagus officinalis] Length = 911 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 480 MSLTQELEKWQSDSDSSLFSTFKGGSSTNHY 388 MSL ELEKWQSDSDSSLF+T+KG SST+HY Sbjct: 881 MSLASELEKWQSDSDSSLFATYKGSSSTSHY 911