BLASTX nr result
ID: Ophiopogon27_contig00051037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00051037 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY62187.1| hypothetical protein RhiirA4_488245 [Rhizophagus ... 68 2e-11 >gb|PKY62187.1| hypothetical protein RhiirA4_488245 [Rhizophagus irregularis] Length = 108 Score = 67.8 bits (164), Expect = 2e-11 Identities = 38/73 (52%), Positives = 44/73 (60%), Gaps = 9/73 (12%) Frame = +1 Query: 1 GIGWFGCGSLIWYRFLCQDPGWNWMIRD------*I*YRCLRFS---GPEI*FDFGLGSS 153 GI WFGC SLIWYRFL PGWNWM+++ + L F G I F+FGLG S Sbjct: 16 GISWFGCRSLIWYRFL---PGWNWMVKNPAPLAVNLVLLILGFEVEFGSRIEFNFGLGFS 72 Query: 154 KIQVGLTWRALSS 192 KIQ L+WR SS Sbjct: 73 KIQAELSWRESSS 85