BLASTX nr result
ID: Ophiopogon27_contig00050911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050911 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK79929.1| uncharacterized protein A4U43_C01F11940 [Asparagu... 56 5e-07 >gb|ONK79929.1| uncharacterized protein A4U43_C01F11940 [Asparagus officinalis] Length = 187 Score = 56.2 bits (134), Expect = 5e-07 Identities = 38/102 (37%), Positives = 54/102 (52%) Frame = +3 Query: 3 DLMKDEQWSSKLKINRKGKTCNVIVFFEEDGDEDTVTACLTESDEEEFVLTTAQLTGTRS 182 DL+ DEQW+++ K K CNV+ D D+ +TA LT+S+E+ V TR+ Sbjct: 6 DLLDDEQWTAQPSKEAKRKYCNVVTAI-LDTDDAAMTA-LTDSEEDTNVF------ATRA 57 Query: 183 DKQFAKQYDQVPD*QPSPSKIVLNPVQATVPKPAQPSSSNPP 308 K+FAKQY P +P+ P A P P +PSS+ P Sbjct: 58 GKEFAKQY---PARTENPAGPPARPAAAVPPNPDEPSSNRQP 96