BLASTX nr result
ID: Ophiopogon27_contig00050529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050529 (803 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY62734.1| hypothetical protein RhiirA4_489768 [Rhizophagus ... 60 1e-07 >gb|PKY62734.1| hypothetical protein RhiirA4_489768 [Rhizophagus irregularis] Length = 154 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 599 RYFYAYFKDDVVLGVAIEESLKKKGLE*MWIIPQK 703 RYFY YFKDDVVLG IEESLKK+GL+ W IPQK Sbjct: 39 RYFYVYFKDDVVLGATIEESLKKEGLDGTWTIPQK 73