BLASTX nr result
ID: Ophiopogon27_contig00050496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050496 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC12944.1| hypothetical protein RhiirA5_352317 [Rhizophagus ... 71 4e-13 gb|PKK75261.1| hypothetical protein RhiirC2_737019, partial [Rhi... 71 6e-13 gb|EXX51763.1| hypothetical protein RirG_258890 [Rhizophagus irr... 71 6e-13 >gb|PKC12944.1| hypothetical protein RhiirA5_352317 [Rhizophagus irregularis] gb|PKC67860.1| hypothetical protein RhiirA1_417627 [Rhizophagus irregularis] gb|PKY19047.1| hypothetical protein RhiirB3_406360 [Rhizophagus irregularis] gb|PKY25214.1| hypothetical protein RhiirB3_413829 [Rhizophagus irregularis] Length = 149 Score = 71.2 bits (173), Expect = 4e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 EYWGIRGRDVREWRSVPYGELGRRERNFRADV 98 EYWGIRGRDVREWRSVPYGELGRRERN RADV Sbjct: 79 EYWGIRGRDVREWRSVPYGELGRRERNLRADV 110 >gb|PKK75261.1| hypothetical protein RhiirC2_737019, partial [Rhizophagus irregularis] Length = 165 Score = 71.2 bits (173), Expect = 6e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 EYWGIRGRDVREWRSVPYGELGRRERNFRADV 98 EYWGIRGRDVREWRSVPYGELGRRERN RADV Sbjct: 97 EYWGIRGRDVREWRSVPYGELGRRERNLRADV 128 >gb|EXX51763.1| hypothetical protein RirG_258890 [Rhizophagus irregularis DAOM 197198w] dbj|GBC21272.1| hypothetical protein RIR_0851300 [Rhizophagus irregularis DAOM 181602] gb|PKY41259.1| hypothetical protein RhiirA4_395696 [Rhizophagus irregularis] gb|POG64191.1| hypothetical protein GLOIN_2v1677643 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 167 Score = 71.2 bits (173), Expect = 6e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 EYWGIRGRDVREWRSVPYGELGRRERNFRADV 98 EYWGIRGRDVREWRSVPYGELGRRERN RADV Sbjct: 97 EYWGIRGRDVREWRSVPYGELGRRERNLRADV 128