BLASTX nr result
ID: Ophiopogon27_contig00050304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050304 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX78336.1| hypothetical protein RirG_015890 [Rhizophagus irr... 70 5e-13 gb|POG60631.1| hypothetical protein GLOIN_2v1711514 [Rhizophagus... 64 6e-11 >gb|EXX78336.1| hypothetical protein RirG_015890 [Rhizophagus irregularis DAOM 197198w] Length = 99 Score = 70.5 bits (171), Expect = 5e-13 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 73 LVEDDDSNDCLGNVTFTKLEDSDTTFEAGDDESNDCV 183 LVEDDDSN CLG+ TFTKLEDSD TFEAGDDE NDCV Sbjct: 42 LVEDDDSNGCLGDATFTKLEDSDITFEAGDDEFNDCV 78 >gb|POG60631.1| hypothetical protein GLOIN_2v1711514 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 76 Score = 64.3 bits (155), Expect = 6e-11 Identities = 31/48 (64%), Positives = 31/48 (64%) Frame = -1 Query: 289 IIHQRLLHQHLQMFSXXXXXXXXXXXXXXXXXRNQLHNHWIHHHLLQM 146 IIHQRLLHQHLQMFS RNQLHNHWIHHHLLQM Sbjct: 29 IIHQRLLHQHLQMFSQSLHHFQQNHHRLRHQKRNQLHNHWIHHHLLQM 76