BLASTX nr result
ID: Ophiopogon27_contig00050190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050190 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX71772.1| hypothetical protein RirG_075410 [Rhizophagus irr... 142 5e-37 gb|PKY38578.1| hypothetical protein RhiirA4_513579 [Rhizophagus ... 142 5e-37 >gb|EXX71772.1| hypothetical protein RirG_075410 [Rhizophagus irregularis DAOM 197198w] gb|EXX74505.1| hypothetical protein RirG_050440 [Rhizophagus irregularis DAOM 197198w] dbj|GBC54237.1| S-antigen protein [Rhizophagus irregularis DAOM 181602] gb|PKC16370.1| hypothetical protein RhiirA5_475679 [Rhizophagus irregularis] gb|PKC75291.1| hypothetical protein RhiirA1_503392 [Rhizophagus irregularis] gb|PKY14082.1| hypothetical protein RhiirB3_502026 [Rhizophagus irregularis] gb|POG73878.1| hypothetical protein GLOIN_2v1826851 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 717 Score = 142 bits (359), Expect = 5e-37 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 177 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN 356 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN Sbjct: 1 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN 60 Query: 357 ISFWPEDL 380 ISFWPEDL Sbjct: 61 ISFWPEDL 68 >gb|PKY38578.1| hypothetical protein RhiirA4_513579 [Rhizophagus irregularis] Length = 718 Score = 142 bits (359), Expect = 5e-37 Identities = 68/68 (100%), Positives = 68/68 (100%) Frame = +3 Query: 177 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN 356 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN Sbjct: 1 MGAAKIERSISPCSQASPTNPTVGSATSYYSPAMDMDPKDMPETAFVIAFCVKFRSAINN 60 Query: 357 ISFWPEDL 380 ISFWPEDL Sbjct: 61 ISFWPEDL 68