BLASTX nr result
ID: Ophiopogon27_contig00050087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050087 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX63252.1| hypothetical protein RirG_153980 [Rhizophagus irr... 115 6e-31 gb|PKC09878.1| hypothetical protein RhiirA5_356151 [Rhizophagus ... 94 9e-23 >gb|EXX63252.1| hypothetical protein RirG_153980 [Rhizophagus irregularis DAOM 197198w] dbj|GBC19063.1| hypothetical protein RIR_0670600 [Rhizophagus irregularis DAOM 181602] gb|PKK72097.1| hypothetical protein RhiirC2_743396 [Rhizophagus irregularis] Length = 80 Score = 115 bits (288), Expect = 6e-31 Identities = 55/80 (68%), Positives = 64/80 (80%), Gaps = 1/80 (1%) Frame = -3 Query: 435 MSASSTISRFGPKNMAMWLTVSIIGAATFYN-AKAQEQKISIQHDLSLHSNDNIERLRNE 259 M+AS+TISRFG KN MWLT SI+G AT Y+ K+Q Q+ Q+DLS HSN NIE LR+E Sbjct: 1 MNASNTISRFGSKNFTMWLTASIVGGATLYSFTKSQVQRTGFQYDLSSHSNGNIENLRSE 60 Query: 258 WKKQNNGFGLRDVTRSCGGV 199 WKKQNNG GL+DVTRSCGGV Sbjct: 61 WKKQNNGIGLKDVTRSCGGV 80 >gb|PKC09878.1| hypothetical protein RhiirA5_356151 [Rhizophagus irregularis] gb|PKC65290.1| hypothetical protein RhiirA1_420630 [Rhizophagus irregularis] gb|PKY22291.1| hypothetical protein RhiirB3_410438 [Rhizophagus irregularis] gb|PKY41945.1| hypothetical protein RhiirA4_396679 [Rhizophagus irregularis] gb|POG67915.1| hypothetical protein GLOIN_2v1642440 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 64 Score = 94.4 bits (233), Expect = 9e-23 Identities = 44/64 (68%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = -3 Query: 387 MWLTVSIIGAATFYN-AKAQEQKISIQHDLSLHSNDNIERLRNEWKKQNNGFGLRDVTRS 211 MWLT SI+G AT Y+ K+Q Q+ Q+DLS HSN NIE LR+EWKKQNNG GL+DVTRS Sbjct: 1 MWLTASIVGGATLYSFTKSQVQRTGFQYDLSSHSNGNIENLRSEWKKQNNGIGLKDVTRS 60 Query: 210 CGGV 199 CGGV Sbjct: 61 CGGV 64