BLASTX nr result
ID: Ophiopogon27_contig00050023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00050023 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY41104.1| intron-binding protein aquarius, partial [Rhizoph... 97 2e-20 gb|PKC06711.1| intron-binding protein aquarius [Rhizophagus irre... 97 2e-20 gb|EXX59721.1| ATP-dependent RNA helicase NAM7 [Rhizophagus irre... 97 2e-20 >gb|PKY41104.1| intron-binding protein aquarius, partial [Rhizophagus irregularis] Length = 1481 Score = 96.7 bits (239), Expect = 2e-20 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -2 Query: 431 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 291 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK Sbjct: 1382 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 1428 >gb|PKC06711.1| intron-binding protein aquarius [Rhizophagus irregularis] gb|PKC76101.1| intron-binding protein aquarius [Rhizophagus irregularis] gb|PKY16370.1| intron-binding protein aquarius [Rhizophagus irregularis] Length = 1483 Score = 96.7 bits (239), Expect = 2e-20 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -2 Query: 431 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 291 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK Sbjct: 1382 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 1428 >gb|EXX59721.1| ATP-dependent RNA helicase NAM7 [Rhizophagus irregularis DAOM 197198w] dbj|GBC11857.1| putative Intron-binding protein aquarius [Rhizophagus irregularis DAOM 181602] gb|POG72336.1| intron-binding protein aquarius [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 1483 Score = 96.7 bits (239), Expect = 2e-20 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = -2 Query: 431 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 291 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK Sbjct: 1382 TIADVTHMGKYVYQMMQEQLAFAKEQKAKMEAMDVDKDEETNLDTKK 1428