BLASTX nr result
ID: Ophiopogon27_contig00049647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00049647 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY46869.1| hypothetical protein RhiirA4_402896 [Rhizophagus ... 75 5e-14 gb|PKK78773.1| hypothetical protein RhiirC2_728801 [Rhizophagus ... 75 5e-14 gb|EXX52113.1| Asg1p [Rhizophagus irregularis DAOM 197198w] >gi|... 75 5e-14 >gb|PKY46869.1| hypothetical protein RhiirA4_402896 [Rhizophagus irregularis] Length = 205 Score = 75.1 bits (183), Expect = 5e-14 Identities = 38/46 (82%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +3 Query: 210 NVKSN-LSFFPAPTASIQNEMPSEVFGYEEENMDKLFTEYIKYEDV 344 NVKS+ L+FF APTA IQNEMPSEVFG E+EN+DKLFTEYIKYEDV Sbjct: 160 NVKSDDLTFFLAPTALIQNEMPSEVFGREQENIDKLFTEYIKYEDV 205 >gb|PKK78773.1| hypothetical protein RhiirC2_728801 [Rhizophagus irregularis] Length = 205 Score = 75.1 bits (183), Expect = 5e-14 Identities = 38/46 (82%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +3 Query: 210 NVKSN-LSFFPAPTASIQNEMPSEVFGYEEENMDKLFTEYIKYEDV 344 NVKS+ L+FF APTA IQNEMPSEVFG E+EN+DKLFTEYIKYEDV Sbjct: 160 NVKSDDLTFFLAPTALIQNEMPSEVFGREQENIDKLFTEYIKYEDV 205 >gb|EXX52113.1| Asg1p [Rhizophagus irregularis DAOM 197198w] dbj|GBC50353.1| c6 transcription factor [Rhizophagus irregularis DAOM 181602] gb|PKB97254.1| hypothetical protein RhiirA5_367500 [Rhizophagus irregularis] gb|PKC62748.1| hypothetical protein RhiirA1_423462 [Rhizophagus irregularis] gb|PKY23769.1| hypothetical protein RhiirB3_412241 [Rhizophagus irregularis] gb|POG73050.1| hypothetical protein GLOIN_2v1590266 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 207 Score = 75.1 bits (183), Expect = 5e-14 Identities = 38/46 (82%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = +3 Query: 210 NVKSN-LSFFPAPTASIQNEMPSEVFGYEEENMDKLFTEYIKYEDV 344 NVKS+ L+FF APTA IQNEMPSEVFG E+EN+DKLFTEYIKYEDV Sbjct: 162 NVKSDDLTFFLAPTALIQNEMPSEVFGREQENIDKLFTEYIKYEDV 207